TkA01G387240 | RubberDandelionOmics

Gene overview

TkA01G387240

Reference: TK1151 Chr: Chr01 Coordinates: 96622358-96627149 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1544 bp · TkA01G387240|TK1151|cDNA

TTTTGCTGCTAAGCCAAAGCTTCACACAAACACAACACCGCCAAGCAAGCAAGCCCTTTCCGAGCCCTATCACCGATCCTACGACGGATGACGACGTAGAAGGGAAGAACAACGGTGGAAACAGTTGAAAGAATATATATATATGCAGCAGTCATATGGTAGTATAGTAAGAAGGCAACAGCAATTAATTAGGTGTTTGGTAGGCGATTACTGCAGCAAAGACACCCTTCATTTGGTAAATAAGGGGATAAGGATGCAAT...

CDS

Download CDS FASTA

1098 bp · TkA01G387240|TK1151|CDS

ATGCAGCAGTCATATGGTAGTATAGTAAGAAGGCAACAGCAATTAATTAGGTGTTTGGTAGGCGATTACTGCAGCAAAGACACCCTTCATTTGGTAAATAAGGGGATAAGGATGCAATCTGTGATGGGTGGTGGAGGTCCCTTAGAAGTTGAGGCTCTCAGTATTTTGAGGTCAATTTCTCCAGTTCTTGATTCAACAAAGCATAAGGGCCAAGCTGGAAAAATAGCGGTTATAGGTGGATGTCGTGAATACACTGGTGC...

Protein

Download Protein FASTA

365 aa · TkA01G387240|TK1151|PROTEIN

MQQSYGSIVRRQQQLIRCLVGDYCSKDTLHLVNKGIRMQSVMGGGGPLEVEALSILRSISPVLDSTKHKGQAGKIAVIGGCREYTGAPYFAAISALKIGADLSHVFCTRDAAPVIKGYSPELIVHPLLEESYNVRDEDKTSISKKVLDEVDKWMERFDCLVIGPGLGRDPFLLDCVSDIMRHARRSNVPMVIDGDGLFLVTNSIDLVKGYPLAVLTPNVNEYKRLVNKVLDCEVNEQDGPQQLLSLAKSIGGVTILRKGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G387240`
TK1151 ID	TkA01G387240
OH-1004 ID	LXL04_003183
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G387240

Location Chr01:96622358-96627149 (+)

Description Similar to VIT_05s0020g02800: ATP-dependent (S)-NAD(P)H-hydrate dehydratase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19150`	Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003183 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006739 NADP+ metabolic process Biological Process

GO:0019674 NAD+ metabolic process Biological Process

GO:0046496 nicotinamide nucleotide metabolic process Biological Process

GO:0110051 metabolite repair Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0047453 ATP-dependent NAD(P)H-hydrate dehydratase activity Molecular Function

KEGG gene cross-reference

ath:AT5G19150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.647

Rank 1 · TkA01G387240 · TK1151

Cytoplasm0.201

Rank 2 · TkA01G387240 · TK1151

Plastid0.114

Rank 3 · TkA01G387240 · TK1151

Nucleus0.110

Rank 4 · TkA01G387240 · TK1151

Peroxisome0.054

Rank 5 · TkA01G387240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01256Carb_kinase76-347 aa

PF02110HK92-165 aa

PF02110HK174-300 aa

PF08543Phos_pyr_kin213-307 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G387240	`PF01256`	Carb_kinase	76	347	1.1e-46	160.0
TkA01G387240	`PF02110`	HK	92	165	0.01	16.0
TkA01G387240	`PF02110`	HK	174	300	0.01	16.0
TkA01G387240	`PF08543`	Phos_pyr_kin	213	307	0.067	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AF2`	Arabidopsis thaliana	sp\|Q94AF2\|NNRD_ARATH ATP-dependent (S)-NAD(P)H-hydrate dehydratase	68.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card