TkA01G382740 | RubberDandelionOmics

Gene overview

TkA01G382740

Reference: TK1151 Chr: Chr01 Coordinates: 95531333-95536371 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3728 bp · TkA01G382740|TK1151|cDNA

TGCAGGGACAGTCGTGAGAGAAAAAAGGAACTTTGGGCTCTCTCTCTCTTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCAATGCAGCAGCCATTAAAGGATCTCTTTAAGTTTCCGCTTTAAACCTGCAACATTAGCTCACTCATTAAACTTCAATTCAACTTTTCTGCTCCTTTTTCCCATCAGCGTTGTTCAAATGTTAATTTGAATGTCTCGGTATTGACTATTACAAGGTCCAGAAAAAGTTCATGTCTACTGCTT...

CDS

Download CDS FASTA

3192 bp · TkA01G382740|TK1151|CDS

ATGAAGTCGAAGACTCGTTTGGACTCTGCCGTATTCCAACTCACGCCGACAAGAACAAGGTGTGATTTATACATCATCGCAAATGACAAGAAAGAGAAAATTGCTTCCGGTTTGCTGAACCCTTTTATTGCGCACCTAAAAACAGCTCAGGATCAGATTGCAAAAGGTGGCTATTCAGTATTTCTTCAACCAGAAGCTAACAGTAATGCAACATGGTTTACCAAGTGTACGGTTGAAAGCTTTGTTCGCTTTGTGAGTAC...

Protein

Download Protein FASTA

1063 aa · TkA01G382740|TK1151|PROTEIN

MKSKTRLDSAVFQLTPTRTRCDLYIIANDKKEKIASGLLNPFIAHLKTAQDQIAKGGYSVFLQPEANSNATWFTKCTVESFVRFVSTPEILERVYTIESEIIQIEEAIAIQGNKDIMIEDQYIKPLVSSEGNKPGHNADDEKAIVLYTPGAHETNSSSGKEGNSKVQLLNVLETRKTVLKKEQGMAFARAVAAGFEIEHVANLLSFAECFGASRLMTACLRYMDLWKQKHESGQWVEIEAEDADYSAAMNASGIVLSSHN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G382740`
TK1151 ID	TkA01G382740
OH-1004 ID	LXL04_003246
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G382740

Location Chr01:95531333-95536371 (+)

Description Similar to CIP7: COP1-interacting protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27430`	Exhibits transcriptional activation activity.	Role of a COP1 interactive protein in mediating light-regulated gene expression in arabidopsis.1998 · DOI: 10.1105/tpc.10.7.1083

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003246 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT4G27430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458

Rank 1 · TkA01G382740 · TK1151

Nucleus0.337

Rank 2 · TkA01G382740 · TK1151

Cell membrane0.327

Rank 3 · TkA01G382740 · TK1151

Endoplasmic reticulum0.061

Rank 4 · TkA01G382740 · TK1151

Golgi apparatus0.046

Rank 5 · TkA01G382740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30469CIP7_N9-64 aa

PF30468CIP7_M88-243 aa

PF24570BACK_BPM_SPOP200-224 aa

PF30468CIP7_M381-408 aa

PF30468CIP7_M472-532 aa

PF30468CIP7_M625-633 aa

PF27950LIAT1656-673 aa

PF27950LIAT1681-702 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G382740	`PF30469`	CIP7_N	9	64	3.7e-25	88.6
TkA01G382740	`PF30468`	CIP7_M	88	243	1.9e-71	240.1
TkA01G382740	`PF24570`	BACK_BPM_SPOP	200	224	0.31	11.9
TkA01G382740	`PF30468`	CIP7_M	381	408	1.9e-71	240.1
TkA01G382740	`PF30468`	CIP7_M	472	532	1.9e-71	240.1
TkA01G382740	`PF30468`	CIP7_M	625	633	1.9e-71	240.1
TkA01G382740	`PF27950`	LIAT1	656	673	1.1	9.8
TkA01G382740	`PF27950`	LIAT1	681	702	1.1	9.8
TkA01G382740	`PF30468`	CIP7_M	877	917	1.9e-71	240.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80386`	Arabidopsis thaliana	sp\|O80386\|CIP7_ARATH COP1-interacting protein 7	36.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card