TkA01G380640 | RubberDandelionOmics

Gene overview

TkA01G380640

Reference: TK1151 Chr: Chr01 Coordinates: 95073888-95075878 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1448 bp · TkA01G380640|TK1151|cDNA

TTGCCCTAATTTATATCCTTTTGTCTTCTTTGCGGATCTAAAACGATACAAGTGACCATCTGTTGGCCGATTTGAAGTATTTTTAGAAAAACATCACCAAAAGAGGGGCATGAAGAAATCGGAGCGGCCAAAGGCATCAAAACACGAAGATGGGGTTGATTTGATCAGTAGCATGCCAGATGGTGTTCTTCTTATGATTCTTTCATGTAATTTACGCACCGAAGAAGTAGTTCGAAGCAGCATTTTGTCCAGACGATGGA...

CDS

Download CDS FASTA

933 bp · TkA01G380640|TK1151|CDS

ATGTCGACCATAGGGAGGTGGATTCATATCGCTGTTACGAGAAATGTCAAACAACTTACCTTGGGGTTTGGCCCTAAGGAGAAGGCCGCAGATGTCGAGCTGCCGCATTGCCTTGTGAATTGTGGTTCGTTAGAGGTATTAAAGTTGTGTTTGTGGGGACGTCATCTAAGGCTACCTAATGTTATGGGGTTTCCGGCGCTTAGGGTTCTTTATTTGAGCGATATTAACTTACCGGAAGACGGCGACTCGATAAAGGGTTT...

Protein

Download Protein FASTA

310 aa · TkA01G380640|TK1151|PROTEIN

MSTIGRWIHIAVTRNVKQLTLGFGPKEKAADVELPHCLVNCGSLEVLKLCLWGRHLRLPNVMGFPALRVLYLSDINLPEDGDSIKGFFKSLPLLEELGLSNCLMGELDLLCISCPKLKTLTVGNIDDLLMCGGIKISCPKLVDLDLTGDIANNFFFECLDSLKKAKIQPKLNGSTISVLFPGISRVEHLSIDLYFFIECINAALDPSLPKMKTLVLKTTLYAFTMDNFNQILKYYPKLKSLKLFIEEEFDEECQWLDEAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G380640`
TK1151 ID	TkA01G380640
OH-1004 ID	LXL04_003257
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.100
Protein coverage (%)	TK1151 99.032 / OH-1004 50.427 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G380640

Location Chr01:95073888-95075878 (+)

Description Similar to At3g52680: F-box/FBD/LRR-repeat protein At3g52680

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At1g69630`	F-box/LRR-repeat protein 13.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At1g66290`	Putative F-box/FBD/LRR-repeat protein At1g66290.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003257 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G69630

ath:AT3G52680

ath:AT4G00160

ath:AT5G56420

ath:AT5G56560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.803

Rank 1 · TkA01G380640 · TK1151

Cytoplasm0.264

Rank 2 · TkA01G380640 · TK1151

Cell membrane0.043

Rank 3 · TkA01G380640 · TK1151

Endoplasmic reticulum0.043

Rank 4 · TkA01G380640 · TK1151

Mitochondrion0.016

Rank 5 · TkA01G380640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622LRR_At1g61320_AtMIF12-262 aa

PF24758LRR_At5g563705-242 aa

PF23320Zn_SUZ1227-57 aa

PF12799LRR_453-77 aa

PF12799LRR_494-128 aa

PF12799LRR_4137-163 aa

PF14088DUF4268152-164 aa

PF12799LRR_4191-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G380640	`PF23622`	LRR_At1g61320_AtMIF1	2	262	5.4e-10	39.9
TkA01G380640	`PF24758`	LRR_At5g56370	5	242	5.9e-14	53.0
TkA01G380640	`PF23320`	Zn_SUZ12	27	57	0.047	14.2
TkA01G380640	`PF12799`	LRR_4	53	77	2.4e-07	31.5
TkA01G380640	`PF12799`	LRR_4	94	128	2.4e-07	31.5
TkA01G380640	`PF12799`	LRR_4	137	163	2.4e-07	31.5
TkA01G380640	`PF14088`	DUF4268	152	164	0.046	14.5
TkA01G380640	`PF12799`	LRR_4	191	216	2.4e-07	31.5
TkA01G380640	`PF14088`	DUF4268	231	284	0.046	14.5
TkA01G380640	`PF12799`	LRR_4	235	243	2.4e-07	31.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	51.900%	Swiss-Prot	Low
`Q9FWZ1`	Arabidopsis thaliana	sp\|Q9FWZ1\|FBL13_ARATH F-box/LRR-repeat protein 13	48.100%	Swiss-Prot	Low
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	39.100%	Swiss-Prot	Medium
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	47.200%	Swiss-Prot	Low
`Q9C8Y8`	Arabidopsis thaliana	sp\|Q9C8Y8\|FDL7_ARATH Putative F-box/FBD/LRR-repeat protein At1g66290	35.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card