TkA01G380380 | RubberDandelionOmics

Gene overview

TkA01G380380

Reference: TK1151 Chr: Chr01 Coordinates: 95012682-95014490 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1736 bp · TkA01G380380|TK1151|cDNA

CATTCCCAACCCATGGCTATCGGATCCGAGAGGCCGCGGATACTAGCGAGGTTCTGTGGCGAAATATTGTAGACTCCGTGCAGCCTTACAAAATGTGGATGCAAAAATCAAGCAAATTTCAGCAAGACGTTCAAAGAATAGGGGTCCAAAAGTAAATTACCCCTAAAACACCGGCACAGAATAAATCTACCGACTATCGATCCTCCATGTCCAGAAATCAAATCTCACTCTGCTTAGCTCTTTGATCAGCCAGTTGCCTC...

CDS

Download CDS FASTA

966 bp · TkA01G380380|TK1151|CDS

ATGACAGCCATTGATGCTGTTACCTCGAAACTGGAGAAATCGGCTAAGATATTTGTCGCCGGCCACCGCGGCCTAGTCGGATCTGCTATCGTACGACGCCTGCGAACCGTCGGCTATACCAATCTCATTATCCGGTCACACACCGAACTAGATCTCACCAACCAGTCCGCCGTCAAAACATTCTTCTCTCTGGAAAAACCCCAATACGTGATCCTCGCAGCAGCCAAAGTCGGTGGGATCCACGCCAACAGCACCTACCC...

Protein

Download Protein FASTA

321 aa · TkA01G380380|TK1151|PROTEIN

MTAIDAVTSKLEKSAKIFVAGHRGLVGSAIVRRLRTVGYTNLIIRSHTELDLTNQSAVKTFFSLEKPQYVILAAAKVGGIHANSTYPADFIAINLQIQTNVIDSAYRYGTKKLVFLGSSCIYPKHAPQPIPESSLLTGPLEPTNEWYAIAKIAGIKMCQAYRIQYNWDAISAMPTNLYGPNDNFHPENSHVLPALMRRFHEAKVAGSKEVVVWGTGSALREFLHVDDLADAVVFLLENYSDLGHVNVGSGKEVSIKELAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G380380`
TK1151 ID	TkA01G380380
OH-1004 ID	LXL04_003262
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G380380

Location Chr01:95012682-95014490 (-)

Description Similar to GER2: Putative GDP-L-fucose synthase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17890`	Catalyzes the two-step NADP-dependent conversion of GDP-4- dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.	No verified direct reference in this release
`At1g73250`	Catalyzes the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0652400`	Catalyzes the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.	No verified direct reference in this release
`Os06g0652300`	Catalyzes the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003262 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006005 L-fucose biosynthetic process Biological Process

GO:0042351 'de novo' GDP-L-fucose biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016853 isomerase activity Molecular Function

GO:0050577 GDP-L-fucose synthase activity Molecular Function

GO:0070401 NADP+ binding Molecular Function

KEGG gene cross-reference

ath:AT1G17890

ath:AT1G73250

dosa:Os06g0652300

dosa:Os06g0652400

rhi:NGR_a00420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.699

Rank 1 · TkA01G380380 · TK1151

Nucleus0.274

Rank 2 · TkA01G380380 · TK1151

Peroxisome0.126

Rank 3 · TkA01G380380 · TK1151

Mitochondrion0.091

Rank 4 · TkA01G380380 · TK1151

Plastid0.046

Rank 5 · TkA01G380380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05368NmrA15-115 aa

PF04321RmlD_sub_bind16-159 aa

PF01370Epimerase17-248 aa

PF02719Polysacc_synt_217-53 aa

PF16363GDP_Man_Dehyd18-45 aa

PF16363GDP_Man_Dehyd49-305 aa

PF02719Polysacc_synt_251-117 aa

PF05368NmrA221-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G380380	`PF05368`	NmrA	15	115	0.23	11.8
TkA01G380380	`PF04321`	RmlD_sub_bind	16	159	2.5e-08	34.1
TkA01G380380	`PF01370`	Epimerase	17	248	9.7e-67	225.6
TkA01G380380	`PF02719`	Polysacc_synt_2	17	53	0.00038	20.5
TkA01G380380	`PF16363`	GDP_Man_Dehyd	18	45	5.9e-21	76.0
TkA01G380380	`PF16363`	GDP_Man_Dehyd	49	305	5.9e-21	76.0
TkA01G380380	`PF02719`	Polysacc_synt_2	51	117	0.00038	20.5
TkA01G380380	`PF05368`	NmrA	221	267	0.23	11.8
TkA01G380380	`PF02719`	Polysacc_synt_2	223	269	0.00038	20.5
TkA01G380380	`PF04321`	RmlD_sub_bind	224	268	2.5e-08	34.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMU0`	Arabidopsis thaliana	sp\|Q9LMU0\|FCL2_ARATH Putative GDP-L-fucose synthase 2	78.800%	Swiss-Prot	High
`O49213`	Arabidopsis thaliana	sp\|O49213\|FCL1_ARATH GDP-L-fucose synthase 1	77.900%	Swiss-Prot	High
`Q67WR2`	Oryza sativa subsp. japonica	sp\|Q67WR2\|FCL1_ORYSJ Probable GDP-L-fucose synthase 1	74.800%	Swiss-Prot	High
`Q67WR5`	Oryza sativa subsp. japonica	sp\|Q67WR5\|FCL2_ORYSJ Putative GDP-L-fucose synthase 2	57.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card