TkA01G380370 | RubberDandelionOmics

Gene overview

TkA01G380370

Reference: TK1151 Chr: Chr01 Coordinates: 95009869-95013037 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1781 bp · TkA01G380370|TK1151|cDNA

GATAAAACCCCGTAGATTAATGGAATCGGATTCATCTCTCCACTAGTCCGTGACTAAATTCTACACTATTAAAACTCATCTAACCCCTTAACAATCCCAATCGAACAAGGATAATGATGGTTCTCAGATTCCGCCTAATGCTCTATTCTGTTCTTTCCATTACCTTCATCGCTTGCGTACAAGCTCAAAATGTTGACGTAATTGACTCAACAATCAAAACAATGGAAGAATTCTCTGGATATCCACTTCATGAAATTGAT...

CDS

Download CDS FASTA

1410 bp · TkA01G380370|TK1151|CDS

ATGATGGTTCTCAGATTCCGCCTAATGCTCTATTCTGTTCTTTCCATTACCTTCATCGCTTGCGTACAAGCTCAAAATGTTGACGTAATTGACTCAACAATCAAAACAATGGAAGAATTCTCTGGATATCCACTTCATGAAATTGATTCCGCCCCTTCATTCTCGGTGGATTCTGCAAATCTTCAGAAACAGATTGATGAACTTTCAAGTTTCTCGGATTCACCAGCCCCTTCGGTAACAAGGATCTTATACAGTGAAAA...

Protein

Download Protein FASTA

469 aa · TkA01G380370|TK1151|PROTEIN

MMVLRFRLMLYSVLSITFIACVQAQNVDVIDSTIKTMEEFSGYPLHEIDSAPSFSVDSANLQKQIDELSSFSDSPAPSVTRILYSENDVLARRFIKNLMDKAGLSVREDAVGNIFGRWEGSEPSLPAVSTGSHIDAIPYSGKYDGVVGVLGAIESINVLKRSGFKPKRSLEVIMFTSEEPTRYGISCLGSRLLAGSESLARSLKQIVVDNDNISFLDAAKSAGYAKTDDFSNVFLDEKSYSAFVELHIEQGPILENEGIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G380370`
TK1151 ID	TkA01G380370
OH-1004 ID	LXL04_003263
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G380370

Location Chr01:95009869-95013037 (+)

Description Similar to UAH: Ureidoglycolate hydrolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g43600`	Involved in the catabolism of purine nucleotides.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0597500`	Involved in the catabolism of purine nucleotides.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003263 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000256 allantoin catabolic process Biological Process

GO:0006144 purine nucleobase metabolic process Biological Process

GO:0006145 purine nucleobase catabolic process Biological Process

GO:0008652 amino acid biosynthetic process Biological Process

GO:0010136 ureide catabolic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0004848 ureidoglycolate hydrolase activity Molecular Function

GO:0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines Molecular Function

GO:0030145 manganese ion binding Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ag:BAA01379

ath:AT5G43600

dosa:Os12g0597500

hin:HI_0588

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.194

Rank 1 · TkA01G380370 · TK1151

Lysosome / Vacuole0.153

Rank 2 · TkA01G380370 · TK1151

Cytoplasm0.146

Rank 3 · TkA01G380370 · TK1151

Plastid0.141

Rank 4 · TkA01G380370 · TK1151

Mitochondrion0.123

Rank 5 · TkA01G380370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04389Peptidase_M28113-218 aa

PF01546Peptidase_M20131-464 aa

PF07687M20_dimer271-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G380370	`PF04389`	Peptidase_M28	113	218	3e-08	34.3
TkA01G380370	`PF01546`	Peptidase_M20	131	464	1.3e-24	88.0
TkA01G380370	`PF07687`	M20_dimer	271	363	0.0038	17.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VXY9`	Arabidopsis thaliana	sp\|Q8VXY9\|UAH_ARATH Ureidoglycolate hydrolase	77.900%	Swiss-Prot	High
`Q2QMN7`	Oryza sativa subsp. japonica	sp\|Q2QMN7\|UAH_ORYSJ Ureidoglycolate hydrolase	75.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card