TkA01G372060 | RubberDandelionOmics

Gene overview

TkA01G372060

Reference: TK1151 Chr: Chr01 Coordinates: 92800033-92801953 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1363 bp · TkA01G372060|TK1151|cDNA

TTAACGTTTTCAATTTTACATCCTTTGTCATCAATCATCTTATTAATACGTATCAAGCGTGTCAACGTGTGCTCGCGTAAGCAGTGACTACAGCGTCGGTGAAGTTTTTGGTAGGTTGAAGAAACGCTAACTTCTATATAAACACCACGCCATCCAATTGACTCCATCATCGATTTCATTTCTTCACCACTGCGAATCAATATGACGATGGCGATGAACGGCATGAAGATTCAAGACACTTTTTACATATCCCACGGATC...

CDS

Download CDS FASTA

828 bp · TkA01G372060|TK1151|CDS

ATGACGATGGCGATGAACGGCATGAAGATTCAAGACACTTTTTACATATCCCACGGATCACCTACCTTGTCAATCGACGAAACTATGCCCGCCAGGCATTTTCTCCAATCATTTCAGCAAAAGGTCTATCCTGCTGATGCCCCTCGACCTACTTCTATCCTCGTAATCTCCGGCCACTGGGAGACTACGTATCCGACGGTCAACGTCGTCAATGGCCCTTCTGACACCATCTACGACTTCTACAATTTTCCCAAAAAAAT...

Protein

Download Protein FASTA

275 aa · TkA01G372060|TK1151|PROTEIN

MTMAMNGMKIQDTFYISHGSPTLSIDETMPARHFLQSFQQKVYPADAPRPTSILVISGHWETTYPTVNVVNGPSDTIYDFYNFPKKMYQLKYPAPGAPKLANWVKELLVSSGFKRVDEEKNRGLDHGAWVPLMLMYPEADIPICQLSVQTNQDATYHYNMGKALAPLKDEGVLIVGSGATTHNLTMLRKTTAVQPWAQEFDAWLKEALIEGRYEDVNEYVEKAPHATVAHPWPDHFYPLHVAMGAGGADSKAQLIHSSWG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G372060`
TK1151 ID	TkA01G372060
OH-1004 ID	LXL04_003336
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G372060

Location Chr01:92800033-92801953 (-)

Description Similar to DODA: 4,5-DOPA dioxygenase extradiol

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15093`	Opens the cyclic ring of caffealdehyde between carbons 2 and 3 or between carbons 4 and 5.	Assembly of an evolutionarily new pathway for α-pyrone biosynthesis in Arabidopsis.2012 · DOI: 10.1126/science.1221614

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003336 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046148 pigment biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0008198 ferrous iron binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen Molecular Function

GO:0050297 stizolobate synthase activity Molecular Function

KEGG gene cross-reference

ath:AT4G15093

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.610

Rank 1 · TkA01G372060 · TK1151

Nucleus0.207

Rank 2 · TkA01G372060 · TK1151

Peroxisome0.161

Rank 3 · TkA01G372060 · TK1151

Mitochondrion0.161

Rank 4 · TkA01G372060 · TK1151

Cell membrane0.048

Rank 5 · TkA01G372060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02900LigB13-271 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G372060	`PF02900`	LigB	13	271	1.8e-51	175.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949R4`	Arabidopsis thaliana	sp\|Q949R4\|DIOXL_ARATH Extradiol ring-cleavage dioxygenase	63.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card