TkA01G362340 | RubberDandelionOmics

Gene overview

TkA01G362340

Reference: TK1151 Chr: Chr01 Coordinates: 90074982-90078162 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2059 bp · TkA01G362340|TK1151|cDNA

AAAGACTTCAACTTGTAAAAACTTTTAAACAACCTTAAAACATGGTTCATGAATCATATCTACTGGCCGACTGGTTCCCGTTTAATTGCTGGCGTAATGAATGCCATGGCGGGCTAACCATTAAAAGTTCGTTTGGTGGTAGTTGCATCCTCCCCCCCTTAAAAACCCCCTAGTCCATCACTTCTATCCCCATACCACGATTTCTCTTTCTGAATCCGTTTCTCCCCTTAAAACCCGTCTAATTTATCTGGGGTTCTGTT...

CDS

Download CDS FASTA

972 bp · TkA01G362340|TK1151|CDS

ATGGTGGTGAATCACTACAAGCTTAGAGGGAATATTTTGAGCTATAACCTCGGTGGGATGGGTTGCAGTGCTGGATTGATCTCCATTGATCTTGCCAAACAACTTTTACAGGTACAACCTAATTCCTATGCATTGGTGGTTAGTATGGAAAACATAACATTAAATTGGTACTTTGGGAACAACCGGTCTATGCTCGTGTCAAATTGTCTGTTTCGAATGGGTGGAGCTGCAATTCTGTTATCTAATCGGTCATCTGATCG...

Protein

Download Protein FASTA

323 aa · TkA01G362340|TK1151|PROTEIN

MVVNHYKLRGNILSYNLGGMGCSAGLISIDLAKQLLQVQPNSYALVVSMENITLNWYFGNNRSMLVSNCLFRMGGAAILLSNRSSDRRRSKYQLIHTVRTHKGADDKCYSCVFQEEDNEKNIGVALSKDLMAVAGEALKTNITTLGPLVLPMSEQLLFFVTLVARKVFKMKIKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLELSEWHMEPSRMTLNRFGNTSSSSLWYELAYTEAKGRIKKGDRSWQIAFGSGFKCNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G362340`
TK1151 ID	TkA01G362340
OH-1004 ID	LXL04_022885
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.200
Protein coverage (%)	TK1151 85.139 / OH-1004 53.398 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G362340

Location Chr01:90074982-90078162 (+)

Description Similar to KCS11: 3-ketoacyl-CoA synthase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04220`	Mediates the synthesis of VLCFAs from 22 to 26 carbons in length (e.g. C22, C24, C26).	Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101 The DAISY gene from Arabidopsis encodes a fatty acid elongase condensing enzyme involved in the biosynthesis of aliphatic suberin in roots and the chalaza-micropyle region of seeds.2009 · DOI: 10.1111/j.1365-313x.2008.03674.x Two Arabidopsis 3-ketoacyl CoA synthase genes, KCS20 and KCS2/DAISY, are functionally redundant in cuticular wax and root suberin biosynthesis, but differentially controlled by osmotic stress.2009 · DOI: 10.1111/j.1365-313x.2009.03973.x
`At5g43760`	Mediates the synthesis of VLCFAs from 22 to 26 carbons in length (e.g. C22, C24, C26).	Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101
`At2g26640`	Active on both saturated and mono-unsaturated acyl chains C16 to C20.	Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162
`At1g01120`	Contributes to cuticular wax and suberin biosynthesis.	KCS1 encodes a fatty acid elongase 3-ketoacyl-CoA synthase affecting wax biosynthesis in Arabidopsis thaliana.1999 · DOI: 10.1046/j.1365-313x.1999.00352.x Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101 Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162
`At2g16280`	Involved in the elongation of C22 to C24 fatty acids, which are precursors for the biosynthesis of cuticular waxes, aliphatic suberins, and membrane lipids, including sphingolipids and phospholipids.	Arabidopsis 3-ketoacyl-coenzyme a synthase9 is involved in the synthesis of tetracosanoic acids as precursors of cuticular waxes, suberins, sphingolipids, and phospholipids.2013 · DOI: 10.1104/pp.112.210450

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022885 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0160062 cutin-based cuticle development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G04220

ath:AT1G19440

ath:AT2G16280

ath:AT2G26640

ath:AT5G43760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.682

Rank 1 · TkA01G362340 · TK1151

Cytoplasm0.081

Rank 2 · TkA01G362340 · TK1151

Cell membrane0.073

Rank 3 · TkA01G362340 · TK1151

Golgi apparatus0.068

Rank 4 · TkA01G362340 · TK1151

Nucleus0.066

Rank 5 · TkA01G362340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08392FAE1_CUT1_RppA1-167 aa

PF00195Chal_sti_synt_N8-80 aa

PF08545ACP_syn_III21-86 aa

PF08541ACP_syn_III_C184-264 aa

PF02797Chal_sti_synt_C186-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G362340	`PF08392`	FAE1_CUT1_RppA	1	167	9.9e-89	298.2
TkA01G362340	`PF00195`	Chal_sti_synt_N	8	80	0.035	14.2
TkA01G362340	`PF08545`	ACP_syn_III	21	86	0.011	16.3
TkA01G362340	`PF08541`	ACP_syn_III_C	184	264	3.8e-11	43.7
TkA01G362340	`PF02797`	Chal_sti_synt_C	186	265	1.3e-09	38.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5XEP9`	Arabidopsis thaliana	sp\|Q5XEP9\|KCS2_ARATH 3-ketoacyl-CoA synthase 2	87.500%	Swiss-Prot	High
`Q9FG87`	Arabidopsis thaliana	sp\|Q9FG87\|KCS20_ARATH 3-ketoacyl-CoA synthase 20	86.400%	Swiss-Prot	High
`O48780`	Arabidopsis thaliana	sp\|O48780\|KCS11_ARATH 3-ketoacyl-CoA synthase 11	85.100%	Swiss-Prot	High
`Q9MAM3`	Arabidopsis thaliana	sp\|Q9MAM3\|KCS1_ARATH 3-ketoacyl-CoA synthase 1	75.800%	Swiss-Prot	High
`Q9SIX1`	Arabidopsis thaliana	sp\|Q9SIX1\|KCS9_ARATH 3-ketoacyl-CoA synthase 9	74.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card