Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2168 bp · TkA01G358100|TK1151|cDNA
TAAAAACCCAAAAGCCGGCGTGATCCGCACCCTATTAATCAGCATAATATTTTCTGTATGAATGTGAGGGATAAAATCCATGGAACCCGCGAAACCACGGATTGCATTCCTCATAATCTCAATAGTAATAATTTCCGATGGGTTGATCTTTAGAGTTTTGGCAGAAGGTGTGACTTATGCCGAATCAAAACAGCTGCGAGATGAGGTTCGTGGAATGTTTTATCATGCATTTGATGGATATATGGATCATGCTTTCCCAC...
1704 bp · TkA01G358100|TK1151|CDS
ATGGAACCCGCGAAACCACGGATTGCATTCCTCATAATCTCAATAGTAATAATTTCCGATGGGTTGATCTTTAGAGTTTTGGCAGAAGGTGTGACTTATGCCGAATCAAAACAGCTGCGAGATGAGGTTCGTGGAATGTTTTATCATGCATTTGATGGATATATGGATCATGCTTTCCCACGTGATGAGTTAAAACCTCTATCATGTGAAGGAGAAGACACACTTGGTGGCTATGCTCTAACTCTGATTGACTCCCTAGA...
Protein
Download Protein FASTA567 aa · TkA01G358100|TK1151|PROTEIN
MEPAKPRIAFLIISIVIISDGLIFRVLAEGVTYAESKQLRDEVRGMFYHAFDGYMDHAFPRDELKPLSCEGEDTLGGYALTLIDSLDTLALLGDKERFTSSVEWISKNIRFNINKTVSLFETTIRIVGGLLSAHLIASDYATGMRIPSYDDELLHLAEDLGRRLLPAFDTPTGIPFGSVNLLHGVDENESKITSTAGGGTLTLEFGVLSRLTNDPIFEQVTKNAVRGIWARRSRINLVGAHIDVFTGEWTQKDAGIGTSI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G358100 |
|---|---|
| TK1151 ID | TkA01G358100 |
| OH-1004 ID | LXL04_002238 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 31.600 |
| Protein coverage (%) | TK1151 77.778 / OH-1004 76.764Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G358100 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:88963118-88967665 (-) | |||||||||
| Description | Similar to MNS1: Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0006491 N-glycan processing Biological Process GO:0036503 ERAD pathway Biological Process GO:0045047 protein targeting to ER Biological Process GO:1904381 Golgi apparatus N-glycan mannose trimming Biological Process GO:0000137 Golgi cis cisterna Cellular Component GO:0000139 Golgi membrane Cellular Component GO:0005768 endosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005802 trans-Golgi network Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G51590 ath:AT3G21160 hsa:10905 mmu:17155 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01532Glyco_hydro_4746-471 aaPF30264YodN_C271-282 aaPF30264YodN_C291-303 aaPF07944Beta-AFase-like_GH127_cat370-402 aaPF30264YodN_C382-404 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G358100 | PF01532 | Glyco_hydro_47 | 46 | 471 | 1.4e-118 | 397.5 |
| TkA01G358100 | PF30264 | YodN_C | 271 | 282 | 1.9 | 9.3 |
| TkA01G358100 | PF30264 | YodN_C | 291 | 303 | 1.9 | 9.3 |
| TkA01G358100 | PF07944 | Beta-AFase-like_GH127_cat | 370 | 402 | 0.13 | 11.9 |
| TkA01G358100 | PF30264 | YodN_C | 382 | 404 | 1.9 | 9.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.