RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G330970
Reference: TK1151 Chr: Chr01 Coordinates: 82247422-82247957 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

464 bp · TkA01G330970|TK1151|cDNA

ATCTGGTTTATCTATCAATGGCTAGGATTGAAGCATTTCACTCGGATCACTAAACAAACACACGGATCGGGTTTCTCATTCACAAAACAGATTAAACAAAGACACGGGAGGCGCCATTCCTCCGACACCAGCCTCGATCTTCACCCTTTCCTCTCCACGCTTGCACGCTTCAAATCAAATGGCGCAAAAATTTCTCGATTTCCTCTGCACGCAGCGTACACAGCCTCGATGCCGGTTTCGATTTCCCTCTCTATATTTAC...

CDS

Download CDS FASTA

303 bp · TkA01G330970|TK1151|CDS

ATCTGGTTTATCTATCAATGGCTAGGATTGAAGCATTTCACTCGGATCACTAAACAAACACACGGATCGGGTTTCTCATTCACAAAACAGATTAAACAAAGACACGGGAGGCGCCATTCCTCCGACACCAGCCTCGATCTTCACCCTTTCCTCTCCACGCTTGCACGCTTCAAATCAAATGGCGCAAAAATTTCTCGATTTCCTCTGCACGCAGCGTACACAGCCTCGATGCCGGTTTCGATTTCCCTCTCTATATTTAC...

Protein

Download Protein FASTA

100 aa · TkA01G330970|TK1151|PROTEIN

IWFIYQWLGLKHFTRITKQTHGSGFSFTKQIKQRHGRRHSSDTSLDLHPFLSTLARFKSNGAKISRFPLHAAYTASMPVSISLSIFTHLKIEVRNQISSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G330970
TK1151 IDTkA01G330970
OH-1004 IDLXL04_021241
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)67.300
Protein coverage (%)TK1151 42.000 / OH-1004 13.382
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G330970
LocationChr01:82247422-82247957 (+)
DescriptionSimilar to CLPR2: ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021241 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0005975 carbohydrate metabolic process Biological Process
GO:0006281 DNA repair Biological Process
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process
GO:0009585 red, far-red light phototransduction Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005654 nucleoplasm Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0009368 endopeptidase Clp complex Cellular Component
KEGG gene cross-reference
ath:AT1G12410
ath:AT4G10180
cyp:PCC8801_0943
pma:Pro_1388
sly:778329
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.410
Rank 1 · TkA01G330970 · TK1151
Nucleus0.401
Rank 2 · TkA01G330970 · TK1151
Mitochondrion0.189
Rank 3 · TkA01G330970 · TK1151
Cell membrane0.089
Rank 4 · TkA01G330970 · TK1151
Endoplasmic reticulum0.066
Rank 5 · TkA01G330970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser