RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G324210
Reference: TK1151 Chr: Chr01 Coordinates: 80674570-80681650 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3009 bp · TkA01G324210|TK1151|cDNA

GTTGCATCATTCACGGGGGAGAAGAATGCGATTGGAAAATATGACGAATCTTTAAAGAAAGCTTACAGGGCTGGGGTGCAAGAGGGACTGGTTGCAGGACTTGGTTCCGGTATATTCATGATGAGCGTATTTTGTTGCTACTCTTTGGCCATATGGTATGGTGGAAGACTGATTATCGAAAAAGGATATACTGGCGGACAGGTCATAAACATCATGGTCGCTGTATTATTAAGCTCTTTTTCTTTAGGGCAGGCGTCACC...

CDS

Download CDS FASTA

3009 bp · TkA01G324210|TK1151|CDS

GTTGCATCATTCACGGGGGAGAAGAATGCGATTGGAAAATATGACGAATCTTTAAAGAAAGCTTACAGGGCTGGGGTGCAAGAGGGACTGGTTGCAGGACTTGGTTCCGGTATATTCATGATGAGCGTATTTTGTTGCTACTCTTTGGCCATATGGTATGGTGGAAGACTGATTATCGAAAAAGGATATACTGGCGGACAGGTCATAAACATCATGGTCGCTGTATTATTAAGCTCTTTTTCTTTAGGGCAGGCGTCACC...

Protein

Download Protein FASTA

1002 aa · TkA01G324210|TK1151|PROTEIN

VASFTGEKNAIGKYDESLKKAYRAGVQEGLVAGLGSGIFMMSVFCCYSLAIWYGGRLIIEKGYTGGQVINIMVAVLLSSFSLGQASPCMSAFASGRVAGFKLFKVIDRKSKIDPYNTNGLKPDDIHGDIELRDVTFSYPARPEERIFDKFCLIIPKGTTMALVGQSGSGKSTVISLIQRFYDPQGGQVIIDAINIKEYNLRWLRGKIGLVSQEPVLFSSSIKDNIAYGKDGATLEEIKAAAKFANAAKFINKFPQGLDTM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G324210
TK1151 IDTkA01G324210
OH-1004 IDLXL04_012713
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)43.700
Protein coverage (%)TK1151 99.601 / OH-1004 75.836
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G324210
LocationChr01:80674570-80681650 (+)
DescriptionSimilar to ABCB1: ABC transporter B family member 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g02520 Involved in the regulation of auxin transport required for pistil elongation.
Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
At2g47000 Auxin influx transporter that mediates the transport of auxin in roots.
PGP4, an ATP binding cassette P-glycoprotein, catalyzes auxin transport in Arabidopsis thaliana roots.2005 · DOI: 10.1105/tpc.105.035816
At3g62150 ABC transporter B family member 21. No verified direct reference in this release
At1g02530 ABC transporter B family member 12. No verified direct reference in this release
At4g01820 ABC transporter B family member 3. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012713 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0008361 regulation of cell size Biological Process
GO:0009555 pollen development Biological Process
GO:0009624 response to nematode Biological Process
GO:0009637 response to blue light Biological Process
GO:0009639 response to red or far red light Biological Process
GO:0009640 photomorphogenesis Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009926 auxin polar transport Biological Process
GO:0009958 positive gravitropism Biological Process
KEGG gene cross-reference
ath:AT1G27940
ath:AT2G36910
ath:AT3G28860
ath:AT4G25960
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.448
Rank 1 · TkA01G324210 · TK1151
Lysosome / Vacuole0.263
Rank 2 · TkA01G324210 · TK1151
Cytoplasm0.144
Rank 3 · TkA01G324210 · TK1151
Endoplasmic reticulum0.124
Rank 4 · TkA01G324210 · TK1151
Golgi apparatus0.059
Rank 5 · TkA01G324210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664ABC_membrane1-78 aa
PF00158Sigma54_activat149-188 aa
PF00005ABC_tran152-296 aa
PF09818ABC_ATPase152-179 aa
PF13481AAA_25153-175 aa
PF12775AAA_7153-182 aa
PF02367TsaE153-179 aa
PF00270DEAD154-190 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G324210PF00664ABC_membrane1782.5e-71241.3
TkA01G324210PF00158Sigma54_activat1491880.02315.1
TkA01G324210PF00005ABC_tran1522963.2e-68229.3
TkA01G324210PF09818ABC_ATPase1521797.7e-1039.0
TkA01G324210PF13481AAA_251531752.6e-0524.7
TkA01G324210PF12775AAA_71531820.007716.5
TkA01G324210PF02367TsaE1531790.06613.9
TkA01G324210PF00270DEAD1541900.0001822.0
TkA01G324210PF00006ATP-synt_ab1541920.00218.5
TkA01G324210PF05783DLIC1541870.004616.6
TkA01G324210PF20720nSTAND31542050.00617.0
TkA01G324210PF06745ATPase1541730.01115.8
TkA01G324210PF13555AAA_291551748.3e-0935.8
TkA01G324210PF03193RsgA_GTPase1561782.3e-0731.5
TkA01G324210PF01583APS_kinase1561888.4e-0523.4
TkA01G324210PF25199nSTAND_NTPase51561740.01415.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FWX7Arabidopsis thalianasp|Q9FWX7|AB11B_ARATH ABC transporter B family member 1165.400%Swiss-ProtHigh
O80725Arabidopsis thalianasp|O80725|AB4B_ARATH ABC transporter B family member 464.700%Swiss-ProtHigh
Q9M1Q9Arabidopsis thalianasp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 2164.000%Swiss-ProtHigh
Q9FWX8Arabidopsis thalianasp|Q9FWX8|AB12B_ARATH ABC transporter B family member 1263.800%Swiss-ProtHigh
Q9SYI2Arabidopsis thalianasp|Q9SYI2|AB3B_ARATH ABC transporter B family member 362.800%Swiss-ProtHigh

JBrowse

View in Genome Browser