TkA01G323110 | RubberDandelionOmics

Gene overview

TkA01G323110

Reference: TK1151 Chr: Chr01 Coordinates: 80392549-80393668 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

522 bp · TkA01G323110|TK1151|cDNA

ATGAATAACAAACTTTCAGGAAATAGGCGATTTTCACGATGGAAAGGATCCGTTGTTGACTCTATAGTCGGAGTATTTCTTACTCAAAACGTCGGTGATAATCTCTCCAGTAATGCCTTCATGGCTCTGGCAGCAAAATATCCACCTCCACCTATAAGAGATTTCGTTGACTGGGAAGCTGTTAAACGAGCATCTGAAGAGGAGATTGCTAAGGTGATTGAGGAAAGAGGCATGAGCAATCAACTTGCCAAAAGAATCAA...

CDS

Download CDS FASTA

522 bp · TkA01G323110|TK1151|CDS

ATGAATAACAAACTTTCAGGAAATAGGCGATTTTCACGATGGAAAGGATCCGTTGTTGACTCTATAGTCGGAGTATTTCTTACTCAAAACGTCGGTGATAATCTCTCCAGTAATGCCTTCATGGCTCTGGCAGCAAAATATCCACCTCCACCTATAAGAGATTTCGTTGACTGGGAAGCTGTTAAACGAGCATCTGAAGAGGAGATTGCTAAGGTGATTGAGGAAAGAGGCATGAGCAATCAACTTGCCAAAAGAATCAA...

Protein

Download Protein FASTA

173 aa · TkA01G323110|TK1151|PROTEIN

MNNKLSGNRRFSRWKGSVVDSIVGVFLTQNVGDNLSSNAFMALAAKYPPPPIRDFVDWEAVKRASEEEIAKVIEERGMSNQLAKRIKNFLDRLVRDHGSMDLEWLRNTPPDKVKEYLLSIDGLGLKSTECVRLLSLLQRAFPVDVNAARVLVRVGWVQLQPLPDGLPIHLLNE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G323110`
TK1151 ID	TkA01G323110
OH-1004 ID	LXL04_012871
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	37.300
Protein coverage (%)	TK1151 97.110 / OH-1004 22.489 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G323110

Location Chr01:80392549-80393668 (+)

Description Similar to DME: Transcriptional activator DEMETER

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q8LK56`	Transcriptional activator involved in gene imprinting.	No verified direct reference in this release
`At2g36490`	Bifunctional DNA glycosylase/lyase, which excises 5-methylcytosine (5-meC) and 5-hydroxymethylcytosine (5-hmeC), leaving an apyrimidinic (AP) site that is subsequently incised by the lyase activity.	ROS1, a repressor of transcriptional gene silencing in Arabidopsis, encodes a DNA glycosylase/lyase.2002 · DOI: 10.1016/s0092-8674(02)01133-9 DEMETER and REPRESSOR OF SILENCING 1 encode 5-methylcytosine DNA glycosylases.2006 · DOI: 10.1073/pnas.0601109103 ROS1 5-methylcytosine DNA glycosylase is a slow-turnover catalyst that initiates DNA demethylation in a distributive fashion.2009 · DOI: 10.1093/nar/gkp390 Methylation-independent DNA binding modulates specificity of Repressor of Silencing 1 (ROS1) and facilitates demethylation in long substrates.2010 · DOI: 10.1074/jbc.m110.124578 DDM1 and ROS1 have a role in UV-B induced- and oxidative DNA damage in A. thaliana.2013 · DOI: 10.3389/fpls.2013.00420 AP endonucleases process 5-methylcytosine excision intermediates during active DNA demethylation in Arabidopsis.2014 · DOI: 10.1093/nar/gku834 The carboxy-terminal domain of ROS1 is essential for 5-methylcytosine DNA glycosylase activity.2014 · DOI: 10.1016/j.jmb.2014.09.010
`At3g10010`	Potential transcriptional activator that may act by nicking the target promoter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0218032`	Bifunctional DNA glycosylase/lyase, which excises 5-methylcytosine (5-meC) and 5-hydroxymethylcytosine (5-hmeC), leaving an apyrimidinic (AP) site that is subsequently incised by the lyase activity (Probable).	A null mutation of ROS1a for DNA demethylation in rice is not transmittable to progeny.2012 · DOI: 10.1111/j.1365-313x.2012.05009.x Mutations in the DNA demethylase OsROS1 result in a thickened aleurone and improved nutritional value in rice grains.2018 · DOI: 10.1073/pnas.1806304115
`Os05g0445900`	Bifunctional DNA glycosylase/lyase, which excises 5-methylcytosine (5-meC) and 5-hydroxymethylcytosine (5-hmeC), leaving an apyrimidinic (AP) site that is subsequently incised by the lyase activity.	A 5-methylcytosine DNA glycosylase/lyase demethylates the retrotransposon Tos17 and promotes its transposition in rice.2011 · DOI: 10.1073/pnas.1112704108

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012871 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006284 base-excision repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0141044 epigenetic programming in the endosperm Biological Process

GO:0141166 chromosomal 5-methylcytosine DNA demethylation pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0043078 polar nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G36490

ath:AT5G04560

dosa:Os01g0217900

osa:9271145

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.354

Rank 1 · TkA01G323110 · TK1151

Cytoplasm0.211

Rank 2 · TkA01G323110 · TK1151

Nucleus0.184

Rank 3 · TkA01G323110 · TK1151

Mitochondrion0.158

Rank 4 · TkA01G323110 · TK1151

Peroxisome0.063

Rank 5 · TkA01G323110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00730HhH-GPD23-161 aa

PF14520HHH_558-90 aa

PF03540TAF10106-146 aa

PF14520HHH_5115-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G323110	`PF00730`	HhH-GPD	23	161	1.6e-09	38.7
TkA01G323110	`PF14520`	HHH_5	58	90	0.21	12.8
TkA01G323110	`PF03540`	TAF10	106	146	0.072	14.0
TkA01G323110	`PF14520`	HHH_5	115	126	0.21	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LK56`	Arabidopsis thaliana	sp\|Q8LK56\|DME_ARATH Transcriptional activator DEMETER	64.700%	Swiss-Prot	Medium
`Q9SJQ6`	Arabidopsis thaliana	sp\|Q9SJQ6\|ROS1_ARATH DNA glycosylase/AP lyase ROS1	63.900%	Swiss-Prot	Medium
`Q9SR66`	Arabidopsis thaliana	sp\|Q9SR66\|DML2_ARATH DEMETER-like protein 2	66.400%	Swiss-Prot	Medium
`C7IW64`	Oryza sativa subsp. japonica	sp\|C7IW64\|ROS1A_ORYSJ Protein ROS1A	63.300%	Swiss-Prot	Medium
`B8YIE8`	Oryza sativa subsp. japonica	sp\|B8YIE8\|ROS1C_ORYSJ Protein ROS1C	64.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card