TkA01G322460 | RubberDandelionOmics

Gene overview

TkA01G322460

Reference: TK1151 Chr: Chr01 Coordinates: 80189358-80190870 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

739 bp · TkA01G322460|TK1151|cDNA

CACACGAAGAAGCGGTTCATGAACCACAATATTGTACAAAATCTTCTTGTAATACCAGATCTGATTTCTGATTGGCGATCTCGGTTGTATTACTACTAAGGAGCTTGGAACAGTTATGAGATCACTAGGACAAAACCCGACTGAAGCTGAACTTCAGGACATGATCAATGAGGTGGATGCTGATGGGAATGGGACAATCGATTTCCCAGAGTTCTTGAATCTGATGGCCCGTAAGATGAAGGACACAGACTCTGAAGAAG...

CDS

Download CDS FASTA

450 bp · TkA01G322460|TK1151|CDS

ATGGCGGATCAGCTTACGGACGATCAGATCTCCGAATTCAAGGAAGCTTTCAGCTTATTCGATAAGGATGGAGATGGTTGTATTACTACTAAGGAGCTTGGAACAGTTATGAGATCACTAGGACAAAACCCGACTGAAGCTGAACTTCAGGACATGATCAATGAGGTGGATGCTGATGGGAATGGGACAATCGATTTCCCAGAGTTCTTGAATCTGATGGCCCGTAAGATGAAGGACACAGACTCTGAAGAAGAGCTCAA...

Protein

Download Protein FASTA

149 aa · TkA01G322460|TK1151|PROTEIN

MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G322460`
TK1151 ID	TkA01G322460
OH-1004 ID	LXL04_003563
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G322460

Location Chr01:80189358-80190870 (-)

Description Similar to Calmodulin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g43810`	Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+).	ABC transporter PEN3/PDR8/ABCG36 interacts with calmodulin that, like PEN3, is required for Arabidopsis nonhost resistance.2016 · DOI: 10.1111/nph.13582

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003563 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005513 detection of calcium ion Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016460 myosin II complex Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0030234 enzyme regulator activity Molecular Function

KEGG gene cross-reference

ath:AT3G43810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.624

Rank 1 · TkA01G322460 · TK1151

Nucleus0.242

Rank 2 · TkA01G322460 · TK1151

Cell membrane0.186

Rank 3 · TkA01G322460 · TK1151

Golgi apparatus0.127

Rank 4 · TkA01G322460 · TK1151

Lysosome / Vacuole0.121

Rank 5 · TkA01G322460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19795DUF62793-17 aa

PF28779Pro_C_rel4-16 aa

PF12763EH6-73 aa

PF31181Pept_C14_Metacaspase6-42 aa

PF21008AIF-17-76 aa

PF24082SPEF2_C7-32 aa

PF25825SAPC2_N8-72 aa

PF20742DUF5580_M11-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G322460	`PF19795`	DUF6279	3	17	0.06	14.0
TkA01G322460	`PF28779`	Pro_C_rel	4	16	0.11	13.4
TkA01G322460	`PF12763`	EH	6	73	3.1e-09	37.4
TkA01G322460	`PF31181`	Pept_C14_Metacaspase	6	42	0.037	15.4
TkA01G322460	`PF21008`	AIF-1	7	76	8.9e-17	62.4
TkA01G322460	`PF24082`	SPEF2_C	7	32	0.015	15.8
TkA01G322460	`PF25825`	SAPC2_N	8	72	1.6e-05	25.4
TkA01G322460	`PF20742`	DUF5580_M	11	82	6.7e-05	23.6
TkA01G322460	`PF22592`	FCaBP_EF-hand	11	35	0.008	17.2
TkA01G322460	`PF00036`	EF-hand_1	12	40	7.2e-42	138.6
TkA01G322460	`PF13499`	EF-hand_7	12	73	2.8e-41	140.4
TkA01G322460	`PF13405`	EF-hand_6	12	41	2.5e-32	108.1
TkA01G322460	`PF13833`	EF-hand_8	12	33	3.1e-28	98.0
TkA01G322460	`PF23564`	EF-hand_FSTL1	12	71	9.5e-12	46.1
TkA01G322460	`PF24784`	Temptin_C	12	35	0.12	13.6
TkA01G322460	`PF24548`	EF_EFCAB10_C	13	56	1.3e-07	31.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P59220`	Arabidopsis thaliana	sp\|P59220\|CALM7_ARATH Calmodulin-7	100.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card