TkA01G322330 | RubberDandelionOmics

Gene overview

TkA01G322330

Reference: TK1151 Chr: Chr01 Coordinates: 80159935-80162129 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1800 bp · TkA01G322330|TK1151|cDNA

GCCTATCAACCTTATTAGTTATTATACACATTTTCTTCAACAGTATCCCTTCAATTATCAATCTCTAGATTCCATTCAATTCAGACACGCACTCCAATTCTCCATTTTATACTACCAAACCCCCGACCACAAAACCCCTCAATTTCCCCCCCAAATTTCGCCAGAAAGCCATGACAATCCAAGCAGAAACCCACCAAATCAAGAAACACAGACACCCCTCAAGAAAACACAGCAAGAAGAAAGACAGCGTCACAGTTGTA...

CDS

Download CDS FASTA

1413 bp · TkA01G322330|TK1151|CDS

ATGACAATCCAAGCAGAAACCCACCAAATCAAGAAACACAGACACCCCTCAAGAAAACACAGCAAGAAGAAAGACAGCGTCACAGTTGTAGTAAACGAGAAATCTCCTCTGATTCCCAAGAAAAAAGGCGCTCACAATGAGTTCAATGGCGCGTCGATGTCGGGGGCTGTCATGAACCTTTCCACCACCATCATCGGCGCCGGAATCATGGCACTCCCAGCCACCATGAAGGTATTAGGCCTCGGCCTTGGTATCGCGGT...

Protein

Download Protein FASTA

470 aa · TkA01G322330|TK1151|PROTEIN

MTIQAETHQIKKHRHPSRKHSKKKDSVTVVVNEKSPLIPKKKGAHNEFNGASMSGAVMNLSTTIIGAGIMALPATMKVLGLGLGIAVIVLVAILSEATVRILLKYSRPGGSDSYGGLMGDAFGDVGKKMLQACVVINNIGVLIIYMIIIGDVVAGSSLDGVHHPGLLEGWFGPHWWTGRIFVLLVTTLGVFVPLASLKRMDSLSVTSSLAVALAVVFLIILAGIAIVKMASGTLQMPRFLPNITDVNSVWNLFTAVPVLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G322330`
TK1151 ID	TkA01G322330
OH-1004 ID	LXL04_021450
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G322330

Location Chr01:80159935-80162129 (+)

Description Similar to AVT6A: Amino acid transporter AVT6A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g30390`	Amino acid transporter AVT6A.	No verified direct reference in this release
`At5g38820`	Amino acid transporter AVT6B.	No verified direct reference in this release
`At3g56200`	Amino acid transporter AVT6C.	No verified direct reference in this release
`At2g40420`	Amino acid transporter AVT6D.	No verified direct reference in this release
`At1g80510`	Amino acid transporter AVT6E.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021450 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G80510

ath:AT2G40420

ath:AT3G30390

ath:AT3G56200

ath:AT5G38820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.350

Rank 1 · TkA01G322330 · TK1151

Lysosome / Vacuole0.329

Rank 2 · TkA01G322330 · TK1151

Endoplasmic reticulum0.175

Rank 3 · TkA01G322330 · TK1151

Golgi apparatus0.113

Rank 4 · TkA01G322330 · TK1151

Cytoplasm0.113

Rank 5 · TkA01G322330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490Aa_trans51-453 aa

PF03222Trp_Tyr_perm52-454 aa

PF14143YrhC188-219 aa

PF14143YrhC373-418 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G322330	`PF01490`	Aa_trans	51	453	1.3e-49	169.7
TkA01G322330	`PF03222`	Trp_Tyr_perm	52	454	1.9e-05	24.7
TkA01G322330	`PF14143`	YrhC	188	219	2.0	9.3
TkA01G322330	`PF14143`	YrhC	373	418	2.0	9.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LI61`	Arabidopsis thaliana	sp\|Q9LI61\|AVT6A_ARATH Amino acid transporter AVT6A	63.600%	Swiss-Prot	High
`F4KBM7`	Arabidopsis thaliana	sp\|F4KBM7\|AVT6B_ARATH Amino acid transporter AVT6B	60.100%	Swiss-Prot	High
`Q9LYM2`	Arabidopsis thaliana	sp\|Q9LYM2\|AVT6C_ARATH Amino acid transporter AVT6C	44.200%	Swiss-Prot	Medium
`Q0WQJ3`	Arabidopsis thaliana	sp\|Q0WQJ3\|AVT6D_ARATH Amino acid transporter AVT6D	42.500%	Swiss-Prot	Medium
`Q9M8L9`	Arabidopsis thaliana	sp\|Q9M8L9\|AVT6E_ARATH Amino acid transporter AVT6E	41.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card