TkA01G320860 | RubberDandelionOmics

Gene overview

TkA01G320860

Reference: TK1151 Chr: Chr01 Coordinates: 79669018-79672112 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1863 bp · TkA01G320860|TK1151|cDNA

ATGGAATTTCAAGAACAAAAGATTGAGAATTTTAAAGGGCAAGCGAGACTCCCAAAATTTGCAGTACCTAAACGCTATAATCTCACTCTAAAACTCGATCTTTCTGCTTCTACTTTTTCTGGGAGCGTTGTTATTGATGTTTTCATTGATGGCCCCACCAAATTTCTAGTCTTGAACTCCCTCGAGCTTGTAATTCATGGAGTCTCCTTCACCAACTTTCACAATCAAAAATATGTTCCATGTGAAATCGTGGTGGATAG...

CDS

Download CDS FASTA

1863 bp · TkA01G320860|TK1151|CDS

ATGGAATTTCAAGAACAAAAGATTGAGAATTTTAAAGGGCAAGCGAGACTCCCAAAATTTGCAGTACCTAAACGCTATAATCTCACTCTAAAACTCGATCTTTCTGCTTCTACTTTTTCTGGGAGCGTTGTTATTGATGTTTTCATTGATGGCCCCACCAAATTTCTAGTCTTGAACTCCCTCGAGCTTGTAATTCATGGAGTCTCCTTCACCAACTTTCACAATCAAAAATATGTTCCATGTGAAATCGTGGTGGATAG...

Protein

Download Protein FASTA

620 aa · TkA01G320860|TK1151|PROTEIN

MEFQEQKIENFKGQARLPKFAVPKRYNLTLKLDLSASTFSGSVVIDVFIDGPTKFLVLNSLELVIHGVSFTNFHNQKYVPCEIVVDSDDETLVLVFEEVLTVGYGVLAIEFSGVPNEHLIGLYRCTYTDKGEKKNTVATQFEAVDARRCFPCWDEPSLKATFKITLESIPLEMTALSNMPIAEEKVNRHFKTIHFEESVLMSTYLVAIVVGLFDYVEATTDDGIKVRAYCPVGKSEKGKFALNVAVKTLDFFQMYFSTPY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G320860`
TK1151 ID	TkA01G320860
OH-1004 ID	LXL04_005585
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	51.800
Protein coverage (%)	TK1151 50.484 / OH-1004 52.867 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G320860

Location Chr01:79669018-79672112 (-)

Description Similar to APM1: Aminopeptidase M1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33090`	Metallopeptidase that binds to the auxin transport inhibitor N-1-naphthylphthalamic acid (NPA).	Identification, purification, and molecular cloning of N-1-naphthylphthalmic acid-binding plasma membrane-associated aminopeptidases from Arabidopsis.2002 · DOI: 10.1104/pp.010519 Mutation of the membrane-associated M1 protease APM1 results in distinct embryonic and seedling developmental defects in Arabidopsis.2009 · DOI: 10.1105/tpc.108.059634 The catalytic and protein-protein interaction domains are required for APM1 function.2010 · DOI: 10.1104/pp.109.148742 Cytoplasm localization of aminopeptidase M1 and its functional activity in root hair cells and BY-2 cells.2012 · DOI: 10.1007/s11033-012-1896-1

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0218200`	Aminopeptidase M1-A.	No verified direct reference in this release
`Os08g0398700`	Aminopeptidase M1-B.	No verified direct reference in this release
`Os09g0362500`	Aminopeptidase M1-C.	No verified direct reference in this release
`Os09g0362800`	Aminopeptidase M1-D.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005585 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0043171 peptide catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004177 aminopeptidase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0010013 N-1-naphthylphthalamic acid binding Molecular Function

GO:0016285 alanyl aminopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT4G33090

dosa:Os02g0218200

dosa:Os08g0398700

dosa:Os09g0362500

dosa:Os09g0362800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.661

Rank 1 · TkA01G320860 · TK1151

Nucleus0.231

Rank 2 · TkA01G320860 · TK1151

Mitochondrion0.084

Rank 3 · TkA01G320860 · TK1151

Cell membrane0.078

Rank 4 · TkA01G320860 · TK1151

Endoplasmic reticulum0.064

Rank 5 · TkA01G320860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17900Peptidase_M1_N22-205 aa

PF07880T4_gp9_10_N64-93 aa

PF01433Peptidase_M1240-456 aa

PF07880T4_gp9_10_N517-557 aa

PF17900Peptidase_M1_N532-554 aa

PF11838ERAP1_C536-615 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G320860	`PF17900`	Peptidase_M1_N	22	205	1.5e-47	162.8
TkA01G320860	`PF07880`	T4_gp9_10_N	64	93	0.075	13.8
TkA01G320860	`PF01433`	Peptidase_M1	240	456	3.4e-82	276.0
TkA01G320860	`PF07880`	T4_gp9_10_N	517	557	0.075	13.8
TkA01G320860	`PF17900`	Peptidase_M1_N	532	554	1.5e-47	162.8
TkA01G320860	`PF11838`	ERAP1_C	536	615	1.5e-20	74.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZH2`	Arabidopsis thaliana	sp\|Q8VZH2\|APM1_ARATH Aminopeptidase M1	58.500%	Swiss-Prot	High
`Q6Z6L4`	Oryza sativa subsp. japonica	sp\|Q6Z6L4\|APM1A_ORYSJ Aminopeptidase M1-A	56.800%	Swiss-Prot	High
`Q0J5V5`	Oryza sativa subsp. japonica	sp\|Q0J5V5\|APM1B_ORYSJ Aminopeptidase M1-B	56.000%	Swiss-Prot	High
`Q0J2B5`	Oryza sativa subsp. japonica	sp\|Q0J2B5\|APM1C_ORYSJ Aminopeptidase M1-C	55.300%	Swiss-Prot	High
`Q6K4E7`	Oryza sativa subsp. japonica	sp\|Q6K4E7\|APM1D_ORYSJ Aminopeptidase M1-D	54.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card