TkA01G317980 | RubberDandelionOmics

Gene overview

TkA01G317980

Reference: TK1151 Chr: Chr01 Coordinates: 78942765-78946145 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1326 bp · TkA01G317980|TK1151|cDNA

ATGAAGAAATCCAAGGGAGGAAATGAGCCAGATGTCGATATGATCAGTAACTTGCCGGATCCTATTCTTCATTTGATTCTTTCACGTATTCCAACTACAGTTGAAGTAGTTCGCACCAGCATTTTGTCCAGACGATGGAGGTATTTGTGGACTTCAGTTCCCTCTATAGACCTTGTATATTTAGAATGTTACCTTATAAAAGTCAACAAGAAGCACTTCGAAGAGTTTGCGTGTCGGGTTTTGCAAATCAGCTCCCTTGA...

CDS

Download CDS FASTA

1326 bp · TkA01G317980|TK1151|CDS

ATGAAGAAATCCAAGGGAGGAAATGAGCCAGATGTCGATATGATCAGTAACTTGCCGGATCCTATTCTTCATTTGATTCTTTCACGTATTCCAACTACAGTTGAAGTAGTTCGCACCAGCATTTTGTCCAGACGATGGAGGTATTTGTGGACTTCAGTTCCCTCTATAGACCTTGTATATTTAGAATGTTACCTTATAAAAGTCAACAAGAAGCACTTCGAAGAGTTTGCGTGTCGGGTTTTGCAAATCAGCTCCCTTGA...

Protein

Download Protein FASTA

441 aa · TkA01G317980|TK1151|PROTEIN

MKKSKGGNEPDVDMISNLPDPILHLILSRIPTTVEVVRTSILSRRWRYLWTSVPSIDLVYLECYLIKVNKKHFEEFACRVLQISSLDLDSFRLCCGDYYDMSTVGRWIDAAVRRNVKLLHLSFSVKDRDDNIEFPHCLLTCGSLEELKFSLDANRLSFPKFTGFLALRVLELEGCKLLNYDLVHNFFKSLTLLEDLSLIGCETYDFRNFSISCPNLKNLRIESLSFHMVYELCNRLEICCPKLVFMEIVGFMSKEIILES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G317980`
TK1151 ID	TkA01G317980
OH-1004 ID	LXL04_026949
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.500
Protein coverage (%)	TK1151 80.499 / OH-1004 49.454 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G317980

Location Chr01:78942765-78946145 (-)

Description Similar to At3g26922: F-box/LRR-repeat protein At3g26922

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78750`	F-box/FBD/LRR-repeat protein At1g78750.	No verified direct reference in this release
`At5g02920`	F-box/LRR-repeat protein 25.	No verified direct reference in this release
`At2g26860`	FBD-associated F-box protein At2g26860.	No verified direct reference in this release
`At5g25850`	Putative F-box/FBD/LRR-repeat protein At5g25850.	No verified direct reference in this release
`At1g78760`	Putative F-box/FBD/LRR-repeat protein At1g78760.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026949 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G13570

ath:AT2G26860

ath:AT3G26922

ath:AT5G44950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.778

Rank 1 · TkA01G317980 · TK1151

Cytoplasm0.279

Rank 2 · TkA01G317980 · TK1151

Cell membrane0.042

Rank 3 · TkA01G317980 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA01G317980 · TK1151

Plastid0.018

Rank 5 · TkA01G317980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box15-54 aa

PF12937F-box-like15-49 aa

PF23622LRR_At1g61320_AtMIF184-356 aa

PF00646F-box86-95 aa

PF24758LRR_At5g56370105-219 aa

PF23320Zn_SUZ12129-153 aa

PF00646F-box178-193 aa

PF00646F-box203-219 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G317980	`PF00646`	F-box	15	54	2.2e-06	28.0
TkA01G317980	`PF12937`	F-box-like	15	49	0.00091	19.7
TkA01G317980	`PF23622`	LRR_At1g61320_AtMIF1	84	356	2.8e-13	50.7
TkA01G317980	`PF00646`	F-box	86	95	2.2e-06	28.0
TkA01G317980	`PF24758`	LRR_At5g56370	105	219	5.8e-10	39.9
TkA01G317980	`PF23320`	Zn_SUZ12	129	153	0.078	13.4
TkA01G317980	`PF00646`	F-box	178	193	2.2e-06	28.0
TkA01G317980	`PF00646`	F-box	203	219	2.2e-06	28.0
TkA01G317980	`PF24758`	LRR_At5g56370	221	350	5.8e-10	39.9
TkA01G317980	`PF23320`	Zn_SUZ12	291	313	0.078	13.4
TkA01G317980	`PF00646`	F-box	334	344	2.2e-06	28.0
TkA01G317980	`PF12937`	F-box-like	334	342	0.00091	19.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV93`	Arabidopsis thaliana	sp\|Q9ZV93\|FDL10_ARATH F-box/FBD/LRR-repeat protein At1g78750	28.800%	Swiss-Prot	Low
`Q1PE04`	Arabidopsis thaliana	sp\|Q1PE04\|FBL25_ARATH F-box/LRR-repeat protein 25	34.300%	Swiss-Prot	Low
`Q84X02`	Arabidopsis thaliana	sp\|Q84X02\|FBD7_ARATH FBD-associated F-box protein At2g26860	25.600%	Swiss-Prot	Low
`Q3E944`	Arabidopsis thaliana	sp\|Q3E944\|FDL33_ARATH Putative F-box/FBD/LRR-repeat protein At5g25850	29.300%	Swiss-Prot	Low
`Q9ZV94`	Arabidopsis thaliana	sp\|Q9ZV94\|FDL11_ARATH Putative F-box/FBD/LRR-repeat protein At1g78760	26.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card