TkA01G313440 | RubberDandelionOmics

Gene overview

TkA01G313440

Reference: TK1151 Chr: Chr01 Coordinates: 77754432-77754944 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

513 bp · TkA01G313440|TK1151|cDNA

GGCCCCTTTTTGCACACCGGAGAGACACCGTATACATCTGCTGTTAGATTCGAGGATTTAAACCTTTCACCAGAGTTATTGAAAGGATTATACGTAGAGATGAAGTTTGAGAGACCAAGTAAGATCCAATCAATAAGCTTGCCGATGATACTAACTCCACCTTATAAGAATCTAATTGCTCAGGCACACAATGGTTCTGGAAAAACAACTTGTTTCGTTCTCGGTATGTTGAGTCGCGTTGATCCGAAGTTTGGTGTGCC...

CDS

Download CDS FASTA

513 bp · TkA01G313440|TK1151|CDS

GGCCCCTTTTTGCACACCGGAGAGACACCGTATACATCTGCTGTTAGATTCGAGGATTTAAACCTTTCACCAGAGTTATTGAAAGGATTATACGTAGAGATGAAGTTTGAGAGACCAAGTAAGATCCAATCAATAAGCTTGCCGATGATACTAACTCCACCTTATAAGAATCTAATTGCTCAGGCACACAATGGTTCTGGAAAAACAACTTGTTTCGTTCTCGGTATGTTGAGTCGCGTTGATCCGAAGTTTGGTGTGCC...

Protein

Download Protein FASTA

170 aa · TkA01G313440|TK1151|PROTEIN

GPFLHTGETPYTSAVRFEDLNLSPELLKGLYVEMKFERPSKIQSISLPMILTPPYKNLIAQAHNGSGKTTCFVLGMLSRVDPKFGVPQALCICPTRELAIRVTLNLQFFLPLLKRAPVTAQVIIGTPGTINKWITAKKLGTSHLKILVFDEADHMLVICKLFYLKLNCWR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G313440`
TK1151 ID	TkA01G313440
OH-1004 ID	LXL04_032596
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	82.400
Protein coverage (%)	TK1151 88.824 / OH-1004 29.210 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G313440

Location Chr01:77754432-77754944 (+)

Description Similar to RH38: DEAD-box ATP-dependent RNA helicase 38

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53110`	ATP-dependent RNA helicase essential for mRNA export from the nucleus.	A DEAD box RNA helicase is essential for mRNA export and important for development and stress responses in Arabidopsis.2005 · DOI: 10.1105/tpc.104.027557

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0158200`	ATP-dependent RNA helicase essential for mRNA export from the nucleus.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032596 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006406 mRNA export from nucleus Biological Process

GO:0006409 tRNA export from nucleus Biological Process

GO:0006415 translational termination Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010467 gene expression Biological Process

GO:0015031 protein transport Biological Process

GO:0016973 poly(A)+ mRNA export from nucleus Biological Process

GO:0051028 mRNA transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

KEGG gene cross-reference

ath:AT3G53110

cal:CAALFM_C301860CA

dosa:Os03g0158200

sce:YOR046C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.438

Rank 1 · TkA01G313440 · TK1151

Cytoplasm0.407

Rank 2 · TkA01G313440 · TK1151

Mitochondrion0.132

Rank 3 · TkA01G313440 · TK1151

Endoplasmic reticulum0.077

Rank 4 · TkA01G313440 · TK1151

Cell membrane0.051

Rank 5 · TkA01G313440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270DEAD41-156 aa

PF04851ResIII56-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G313440	`PF00270`	DEAD	41	156	1.4e-21	77.6
TkA01G313440	`PF04851`	ResIII	56	154	0.002	18.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZG7`	Arabidopsis thaliana	sp\|Q93ZG7\|RH38_ARATH DEAD-box ATP-dependent RNA helicase 38	66.500%	Swiss-Prot	High
`Q10RI7`	Oryza sativa subsp. japonica	sp\|Q10RI7\|RH38_ORYSJ DEAD-box ATP-dependent RNA helicase 38	60.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card