TkA01G291450 | RubberDandelionOmics

Gene overview

TkA01G291450

Reference: TK1151 Chr: Chr01 Coordinates: 72628303-72629010 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · TkA01G291450|TK1151|cDNA

ATGACGGACAAAAAGCAGCTCATCTTGGTGGTCGAAGGTACCGCCGCCCTGGGGCCTTACTGGCGCACCATAGTCTCAGATTACCTCGAAAACGTTATCAGATCCTTCTGTGATAGTGAGTCTTTGGTAAGTCTCCATCTGATAAACCCACGTCAGCAGCAGAGCATGCTGCCAGGTCATCTTGGTCAAGGTGAACAGGTTTCGTTAAGGCAGGGTAGTGGTAGTGGTGTTGGTGTGTCATCATCTATGCAAATGCAACC...

CDS

Download CDS FASTA

423 bp · TkA01G291450|TK1151|CDS

ATGACGGACAAAAAGCAGCTCATCTTGGTGGTCGAAGGTACCGCCGCCCTGGGGCCTTACTGGCGCACCATAGTCTCAGATTACCTCGAAAACGTTATCAGATCCTTCTGTGATAGTGAGTCTTTGGTAAGTCTCCATCTGATAAACCCACGTCAGCAGCAGAGCATGCTGCCAGGTCATCTTGGTCAAGGTGAACAGGTTTCGTTAAGGCAGGGTAGTGGTAGTGGTGTTGGTGTGTCATCATCTATGCAAATGCAACC...

Protein

Download Protein FASTA

140 aa · TkA01G291450|TK1151|PROTEIN

MTDKKQLILVVEGTAALGPYWRTIVSDYLENVIRSFCDSESLVSLHLINPRQQQSMLPGHLGQGEQVSLRQGSGSGVGVSSSMQMQPPQSMLTGQQMNRSSPQPTGSSNSAGGGPPNAQKGQVAQRGPHSGFTKQQFHVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G291450`
TK1151 ID	TkA01G291450
OH-1004 ID	LXL04_003717
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	86.800
Protein coverage (%)	TK1151 99.286 / OH-1004 54.513 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G291450

Location Chr01:72628303-72629010 (+)

Description Similar to TKI1: TSL-kinase interacting protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25540`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	Regulation of flowering time by light quality.2003 · DOI: 10.1038/nature01636 Purification of a plant mediator from Arabidopsis thaliana identifies PFT1 as the Med25 subunit.2007 · DOI: 10.1016/j.molcel.2007.05.007 Acceleration of flowering during shade avoidance in Arabidopsis alters the balance between FLOWERING LOCUS C-mediated repression and photoperiodic induction of flowering.2008 · DOI: 10.1104/pp.108.125468 The mediator complex subunit PFT1 is a key regulator of jasmonate-dependent defense in Arabidopsis.2009 · DOI: 10.1105/tpc.109.066910 The Arabidopsis thaliana Med25 mediator subunit integrates environmental cues to control plant development.2011 · DOI: 10.1073/pnas.1002981108 PFT1, the MED25 subunit of the plant Mediator complex, promotes flowering through CONSTANS dependent and independent mechanisms in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2011.04815.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003717 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006534 cysteine metabolic process Biological Process

GO:0006535 L-cysteine biosynthetic process from L-serine Biological Process

GO:0007389 pattern specification process Biological Process

GO:0009611 response to wounding Biological Process

GO:0009836 fruit ripening, climacteric Biological Process

GO:0019499 cyanide metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003682 chromatin binding Molecular Function

KEGG gene cross-reference

ath:AT2G36960

mdm:103401891

mdm:103405317

sot:102601315

sot:102604154

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.709

Rank 1 · TkA01G291450 · TK1151

Cytoplasm0.421

Rank 2 · TkA01G291450 · TK1151

Cell membrane0.035

Rank 3 · TkA01G291450 · TK1151

Mitochondrion0.033

Rank 4 · TkA01G291450 · TK1151

Endoplasmic reticulum0.029

Rank 5 · TkA01G291450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11265Med25_VWA4-37 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G291450	`PF11265`	Med25_VWA	4	37	2.7e-05	24.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XYY2`	Arabidopsis thaliana	sp\|Q7XYY2\|MED25_ARATH Mediator of RNA polymerase II transcription subunit 25	76.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card