TkA01G284950 | RubberDandelionOmics

Gene overview

TkA01G284950

Reference: TK1151 Chr: Chr01 Coordinates: 71137132-71141804 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3329 bp · TkA01G284950|TK1151|cDNA

AAAAAAATAAAAAATGAGAGACGGGGGAAGAGGGGGGGAAGAGACGCACGAGGTCACACAATTCCACATTCCACTCGTTTCTCTTCTAACCCTACGCCTTCTCCTCTCTAACTCAAAACCTAAATCGACAGTAGAGACTAGAGAGGCGCCGCGATTTCGACTGCAACCGAGCAAGAGCTTCTCACAGCTTCGCCGTCCCTGAGCTTTCCACTCGTCGGCATCGGCATCTTCCAATCGGCATCAGCATCTTCCAATCGACG...

CDS

Download CDS FASTA

2289 bp · TkA01G284950|TK1151|CDS

ATGTTGGGCTCATTGCCAATATTACCCCTCCCAGCACCACCAACCGATGGCAACCTGGGCCCACTTCCACCATCCCAAGTACAAGACCAGCATATGCAGGAGACTGAGGATGACCGGAATAACAAATCCAATTCCAATTCCGCCCCGGCATCAATCGCCACACACACCAGAACAATCGGAATCATACATCCGCCACCAGACATCCGAACAATCGTCGACAAAACCGCCAGTTTTGTAGCAAAAAACGGACCCGAGTTTGA...

Protein

Download Protein FASTA

762 aa · TkA01G284950|TK1151|PROTEIN

MLGSLPILPLPAPPTDGNLGPLPPSQVQDQHMQETEDDRNNKSNSNSAPASIATHTRTIGIIHPPPDIRTIVDKTASFVAKNGPEFEKRIIISNAGNPKFNFLNGSDPYHAYYQHRLAEFRSQNQNPTDVPPPETAAPATDPPETIDPSAKFRPVKKILDPPEAEQYTIRLPEGITGEELDIIKLTAQFVARNGKSFLTGLTSRENNNPQFHFLKPTHSMFMFFTSLADAYSKVLMPPKGLPEKLKKSVTDMTTVLERAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G284950`
TK1151 ID	TkA01G284950
OH-1004 ID	LXL04_003740
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G284950

Location Chr01:71137132-71141804 (-)

Description Similar to At1g14650: Probable splicing factor 3A subunit 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14650`	Probable splicing factor 3A subunit 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003740 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000387 spliceosomal snRNP assembly Biological Process

GO:0000389 mRNA 3'-splice site recognition Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0045292 mRNA cis splicing, via spliceosome Biological Process

GO:1903241 U2-type prespliceosome assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005684 U2-type spliceosomal complex Cellular Component

GO:0005686 U2 snRNP Cellular Component

GO:0016607 nuclear speck Cellular Component

KEGG gene cross-reference

ath:AT1G14650

bta:504381

ddi:DDB_G0272676

hsa:10291

mmu:67465

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.893

Rank 1 · TkA01G284950 · TK1151

Cytoplasm0.247

Rank 2 · TkA01G284950 · TK1151

Cell membrane0.023

Rank 3 · TkA01G284950 · TK1151

Mitochondrion0.019

Rank 4 · TkA01G284950 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA01G284950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12230PRP21_like_P30-44 aa

PF01805Surp64-127 aa

PF01805Surp175-239 aa

PF12230PRP21_like_P249-472 aa

PF12230PRP21_like_P486-507 aa

PF00240ubiquitin701-756 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G284950	`PF12230`	PRP21_like_P	30	44	5.5e-54	184.0
TkA01G284950	`PF01805`	Surp	64	127	1.2e-50	169.7
TkA01G284950	`PF01805`	Surp	175	239	1.2e-50	169.7
TkA01G284950	`PF12230`	PRP21_like_P	249	472	5.5e-54	184.0
TkA01G284950	`PF12230`	PRP21_like_P	486	507	5.5e-54	184.0
TkA01G284950	`PF00240`	ubiquitin	701	756	5.4e-05	23.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXF1`	Arabidopsis thaliana	sp\|Q8RXF1\|SF3A1_ARATH Probable splicing factor 3A subunit 1	60.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card