RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G235410
Reference: TK1151 Chr: Chr01 Coordinates: 59641277-59641763 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

372 bp · TkA01G235410|TK1151|cDNA

CGTTTATACTTCACCGTCAACAAAACCAAGCACCAAGCAACCTCCCTAGAGTTCAGCTCTGGCAATCGCAACCCACGCATCACAACATCGTCAATTTCTGATCGATGGCACTCTGGACAAGCAATCACCAGACGAATCATGAGCTCAAGCTCGGCCGTACATGGCTCGCGATCCATGTCTTCATGGTGGAAAAATGTTGAGCCTGCACCGAAAGATCCCATTCTTGGTGCAACCGGAGCTTTTCTTACAGATCCTAGTCC...

CDS

Download CDS FASTA

372 bp · TkA01G235410|TK1151|CDS

CGTTTATACTTCACCGTCAACAAAACCAAGCACCAAGCAACCTCCCTAGAGTTCAGCTCTGGCAATCGCAACCCACGCATCACAACATCGTCAATTTCTGATCGATGGCACTCTGGACAAGCAATCACCAGACGAATCATGAGCTCAAGCTCGGCCGTACATGGCTCGCGATCCATGTCTTCATGGTGGAAAAATGTTGAGCCTGCACCGAAAGATCCCATTCTTGGTGCAACCGGAGCTTTTCTTACAGATCCTAGTCC...

Protein

Download Protein FASTA

123 aa · TkA01G235410|TK1151|PROTEIN

RLYFTVNKTKHQATSLEFSSGNRNPRITTSSISDRWHSGQAITRRIMSSSSAVHGSRSMSSWWKNVEPAPKDPILGATGAFLTDPSPDKVNVGFGDYRDDNRKPVVLDHILGRGSTISSDFSH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G235410
TK1151 IDTkA01G235410
OH-1004 IDLXL04_002586
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)97.500
Protein coverage (%)TK1151 99.187 / OH-1004 93.846
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G235410
LocationChr01:59641277-59641763 (-)
DescriptionSimilar to ASP1: Aspartate aminotransferase, mitochondrial
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g30970 Amino acid aminotransferase important for the metabolism of amino acids and Krebs-cycle related organic acids. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_002586 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006103 2-oxoglutarate metabolic process Biological Process
GO:0006531 aspartate metabolic process Biological Process
GO:0006532 L-aspartate biosynthetic process Biological Process
GO:0006533 L-aspartate catabolic process Biological Process
GO:0006536 glutamate metabolic process Biological Process
GO:0006869 lipid transport Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0005759 mitochondrial matrix Cellular Component
GO:0005777 peroxisome Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004069 L-aspartate:2-oxoglutarate aminotransferase activity Molecular Function
KEGG gene cross-reference
ath:AT2G30970
ddi:DDB_G0268664
dre:406688
xtr:549687
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.419
Rank 1 · TkA01G235410 · TK1151
Mitochondrion0.335
Rank 2 · TkA01G235410 · TK1151
Nucleus0.140
Rank 3 · TkA01G235410 · TK1151
Cytoplasm0.116
Rank 4 · TkA01G235410 · TK1151
Cell membrane0.035
Rank 5 · TkA01G235410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P46643Arabidopsis thalianasp|P46643|AAT1_ARATH Aspartate aminotransferase, mitochondrial81.500%Swiss-ProtLow

JBrowse

View in Genome Browser