TkA01G217170 | RubberDandelionOmics

Gene overview

TkA01G217170

Reference: TK1151 Chr: Chr01 Coordinates: 55359549-55365477 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1981 bp · TkA01G217170|TK1151|cDNA

TAAAAATCATAATGCATGGATTGTTTTTTTCATTTTTGCCGTTTTCCTTGTTCTATCAAGATCAGACGGCCGTTAACTTTAACTTCTCTTTCTTACGTATTGTAGGGAGATGCCTATAAATGAAGCCGTTACGTTGGGTGTACACCTTTGATACTCCCATCATCCTACACACATTCCACCTTCTTCCTCCACTTTTAGATCCAATACCACACATACTGTGTGAATAGTTTTATACAGCACAGAAAGGTGGACACTGTGTG...

CDS

Download CDS FASTA

1347 bp · TkA01G217170|TK1151|CDS

ATGGAGGTACCTAAAAAGTGGATCTCTCATAGCTCCGTTCTGTTACTAATGCTGTTGCTTGTTGGAGTTGCTGCAGCTTCTACCCTTGTGAATGGCGATACCTCAAACCCTAGGAATATCGAGATAGAAGAGTTGCAGAGCTCCAATGACTCATCAATGGCTTCCAGAATAAAGGAGATTGAAACTTTGAACGAAAAGGCAGTTCAAGACCCGGAGGAGGTAGTCGCCATGGTTGAAATGAGCATAAAAAACAGCACAGA...

Protein

Download Protein FASTA

448 aa · TkA01G217170|TK1151|PROTEIN

MEVPKKWISHSSVLLLMLLLVGVAAASTLVNGDTSNPRNIEIEELQSSNDSSMASRIKEIETLNEKAVQDPEEVVAMVEMSIKNSTERRKLGYFSCGTGNPIDDCWRCDRNWQRNRRRLADCGIGFGRNAIGGRDGRFYVVTDSSDNDPVNPRPGTLRHAVIQDAPLWIVFKRDMVIQLKQELIMNSFKTIDARGVNVHIANGACLTIQFVTNIIVHGLHIHECKPTGNALVRSSPSHYGWRTMADGDAISIFGSSHIWI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G217170`
TK1151 ID	TkA01G217170
OH-1004 ID	LXL04_033309
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.200
Protein coverage (%)	TK1151 100.000 / OH-1004 99.555 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G217170

Location Chr01:55359549-55365477 (+)

Description Similar to At4g13710: Probable pectate lyase 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07010`	Probable pectate lyase 8.	No verified direct reference in this release
`At4g13710`	Probable pectate lyase 15.	No verified direct reference in this release
`At5g48900`	Probable pectate lyase 20.	No verified direct reference in this release
`At3g24670`	Probable pectate lyase 10.	No verified direct reference in this release
`At4g13210`	Putative pectate lyase 14.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033309 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045490 pectin catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0030570 pectate lyase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G04680

ath:AT3G07010

ath:AT3G24230

ath:AT3G24670

ath:AT4G13710

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.473

Rank 1 · TkA01G217170 · TK1151

Lysosome / Vacuole0.200

Rank 2 · TkA01G217170 · TK1151

Cytoplasm0.112

Rank 3 · TkA01G217170 · TK1151

Endoplasmic reticulum0.097

Rank 4 · TkA01G217170 · TK1151

Cell membrane0.073

Rank 5 · TkA01G217170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26448DUF81279-84 aa

PF26448DUF8127133-146 aa

PF00544Pectate_lyase_4185-381 aa

PF13229Beta_helix208-294 aa

PF05048NosD245-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G217170	`PF26448`	DUF8127	9	84	0.1	12.4
TkA01G217170	`PF26448`	DUF8127	133	146	0.1	12.4
TkA01G217170	`PF00544`	Pectate_lyase_4	185	381	2.4e-19	70.3
TkA01G217170	`PF13229`	Beta_helix	208	294	0.0013	19.1
TkA01G217170	`PF05048`	NosD	245	319	0.01	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8Z8`	Arabidopsis thaliana	sp\|Q9M8Z8\|PLY8_ARATH Probable pectate lyase 8	83.200%	Swiss-Prot	High
`Q944R1`	Arabidopsis thaliana	sp\|Q944R1\|PLY15_ARATH Probable pectate lyase 15	72.600%	Swiss-Prot	High
`Q93WF1`	Arabidopsis thaliana	sp\|Q93WF1\|PLY20_ARATH Probable pectate lyase 20	80.400%	Swiss-Prot	High
`Q9LJ42`	Arabidopsis thaliana	sp\|Q9LJ42\|PLY10_ARATH Probable pectate lyase 10	80.500%	Swiss-Prot	High
`Q9SVQ6`	Arabidopsis thaliana	sp\|Q9SVQ6\|PLY14_ARATH Putative pectate lyase 14	76.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card