TkA01G216870 | RubberDandelionOmics

Gene overview

TkA01G216870

Reference: TK1151 Chr: Chr01 Coordinates: 55269864-55270187 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA01G216870|TK1151|cDNA

ATGGGAACTCTTTTGATGAGTGTATCAAGGAAAGGTCAAGAGACTCAGGGCGTTGAACAATGTTGTAATGAGCTTCAGAACGTTGAGGAGGAGTGTCAGTGTGAGGCTATGAAGGAGGTTTACAGGCAAGTCGAGCAGATGGAGACACAAGGGAGACGACAGGGTGGTCGCCAAACACAAGACATGCAACAAATTGTTGAGAATCTAAGAAATCAATGCATATTACAAGTCCAACAATACAGAATCCCATCCGCAATGTT...

CDS

Download CDS FASTA

324 bp · TkA01G216870|TK1151|CDS

ATGGGAACTCTTTTGATGAGTGTATCAAGGAAAGGTCAAGAGACTCAGGGCGTTGAACAATGTTGTAATGAGCTTCAGAACGTTGAGGAGGAGTGTCAGTGTGAGGCTATGAAGGAGGTTTACAGGCAAGTCGAGCAGATGGAGACACAAGGGAGACGACAGGGTGGTCGCCAAACACAAGACATGCAACAAATTGTTGAGAATCTAAGAAATCAATGCATATTACAAGTCCAACAATACAGAATCCCATCCGCAATGTT...

Protein

Download Protein FASTA

107 aa · TkA01G216870|TK1151|PROTEIN

MGTLLMSVSRKGQETQGVEQCCNELQNVEEECQCEAMKEVYRQVEQMETQGRRQGGRQTQDMQQIVENLRNQCILQVQQYRIPSAMFFKLESNDRVTNVFRISSFYT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G216870`
TK1151 ID	TkA01G216870
OH-1004 ID	LXL04_037844
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.100
Protein coverage (%)	TK1151 81.308 / OH-1004 32.197 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G216870`
Location	Chr01:55269864-55270187 (-)
Description	Similar to HAG5: 2S seed storage protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037844` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002229 defense response to oomycetes Biological Process GO:0031640 killing of cells of another organism Biological Process GO:0050832 defense response to fungus Biological Process GO:0000322 storage vacuole Cellular Component GO:0033095 aleurone grain Cellular Component GO:0045735 nutrient reservoir activity Molecular Function
KEGG gene cross-reference	rcu:8280732 rcu:8280733 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.435

Rank 1 · TkA01G216870 · TK1151

Nucleus0.294

Rank 2 · TkA01G216870 · TK1151

Extracellular0.260

Rank 3 · TkA01G216870 · TK1151

Endoplasmic reticulum0.094

Rank 4 · TkA01G216870 · TK1151

Mitochondrion0.088

Rank 5 · TkA01G216870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00234Tryp_alpha_amyl12-79 aa

PF12268DUF361217-46 aa

PF05617Prolamin_like19-44 aa

PF25051WHD_MCM822-51 aa

PF04129Vps52_CC33-89 aa

PF25051WHD_MCM858-75 aa

PF12268DUF361258-102 aa

PF05617Prolamin_like67-81 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G216870	`PF00234`	Tryp_alpha_amyl	12	79	1.3e-07	32.5
TkA01G216870	`PF12268`	DUF3612	17	46	0.17	12.7
TkA01G216870	`PF05617`	Prolamin_like	19	44	0.11	13.4
TkA01G216870	`PF25051`	WHD_MCM8	22	51	0.15	12.9
TkA01G216870	`PF04129`	Vps52_CC	33	89	0.063	13.7
TkA01G216870	`PF25051`	WHD_MCM8	58	75	0.15	12.9
TkA01G216870	`PF12268`	DUF3612	58	102	0.17	12.7
TkA01G216870	`PF05617`	Prolamin_like	67	81	0.11	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card