TkA01G207930 | RubberDandelionOmics

Gene overview

TkA01G207930

Reference: TK1151 Chr: Chr01 Coordinates: 52908811-52910979 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1922 bp · TkA01G207930|TK1151|cDNA

GTTTGAACCCGGGTTCGTTGGGTGCTATAGCATACTGCCCTATCGAATGTTACTGCCCACTACACCAAACCGCCGTTAAAAAAAAAAAAAAATAAATGTCCAAAATTCAGCTCCATTTTAAAACTCAGTCCTGTTTGAGTATGTTTGTGGTTGCCTGTATCATCCGCCCCGCCCCTCCCTTAAAACAGCCTCCATATCGACTACCACCACCGGCGCAGGTTAGGTTATATGGATACATATTTATCAGTAAAGACTACCTA...

CDS

Download CDS FASTA

1449 bp · TkA01G207930|TK1151|CDS

ATGAAAATGCACAGGCTCAGAAAGAAACCCACAAACACTTTCAGATCTAAGCGCCTCCTCTCATTCTCTCTCCTCGCAATCTTCTTCGTTCTTCTCTTTTGTTTCTCCAACAAGTACACCATCAACTCCCTCTTATTCTCAAATTCCCTAAAACCCACCCGAATTCCCCAATGCCTCAAACGGGACCTCGCGCAATCCCTAAATGGACAGAAATTCCTTTGGTACGCACCACACAGTGGGTTCAGCAACCAGCTTTCTGA...

Protein

Download Protein FASTA

482 aa · TkA01G207930|TK1151|PROTEIN

MKMHRLRKKPTNTFRSKRLLSFSLLAIFFVLLFCFSNKYTINSLLFSNSLKPTRIPQCLKRDLAQSLNGQKFLWYAPHSGFSNQLSEFKNAVLLSAILNRTLIIPPVLDHHAVVLGSCPKFRVSEPKELRFAVWNHAIQLIQSRRYVSMADIIDLSSLVSNSAIKVIDFRNFISQFCDIDFNYLCVKDSRTEDSFLEKLRQCGSLLSGYNTDLNDCVYGVEEDCRTTVWTYQRDNKNGSLDPFQPDEQLKKKKNISFIRK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G207930`
TK1151 ID	TkA01G207930
OH-1004 ID	LXL04_004065
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.300
Protein coverage (%)	TK1151 99.793 / OH-1004 92.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G207930

Location Chr01:52908811-52910979 (-)

Description Similar to OFUT30: O-fucosyltransferase 30

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17430`	O-fucosyltransferase 30.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004065 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016020 membrane Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G17430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.564

Rank 1 · TkA01G207930 · TK1151

Endoplasmic reticulum0.223

Rank 2 · TkA01G207930 · TK1151

Cytoplasm0.097

Rank 3 · TkA01G207930 · TK1151

Cell membrane0.083

Rank 4 · TkA01G207930 · TK1151

Lysosome / Vacuole0.073

Rank 5 · TkA01G207930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11466Doppel20-34 aa

PF10250O-FucT72-348 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G207930	`PF11466`	Doppel	20	34	0.82	10.1
TkA01G207930	`PF10250`	O-FucT	72	348	1.3e-07	32.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1JPM5`	Arabidopsis thaliana	sp\|Q1JPM5\|OFT30_ARATH O-fucosyltransferase 30	53.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card