TkA01G203420 | RubberDandelionOmics

Gene overview

TkA01G203420

Reference: TK1151 Chr: Chr01 Coordinates: 51774034-51779308 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4030 bp · TkA01G203420|TK1151|cDNA

GATCCCGAATTTGTTTTGAATTTTTAGATCCCCCAAACCCCTTTCAAACGGCTACAACTCCTTGTCTCTCCCCTTCCCTCTCTTTACAGTCTCGACTGTGCATCTCATCACAATATCTCGCTACTTTGTCTGTCCGAAATCAGAACCCTAAATCTTTTACACACTCTCGATCACCACTGTGAACAAGATTTCTTAAAAGATGAAGCGTTTTATTCAACCAAAAAGCCCCATCTTGAGAGAGAATTCTGTGGATACACCAC...

CDS

Download CDS FASTA

3336 bp · TkA01G203420|TK1151|CDS

ATGAAGCGTTTTATTCAACCAAAAAGCCCCATCTTGAGAGAGAATTCTGTGGATACACCACCTTCAAACCCTACTTCGGTAAAGCAGAGCAAATCTTCTAGTCGAAAGAAATCCCCAAAAGAAAATGTTGCACCTTCTGATCCGAACGCAATTCCAGATTCATCTCCTTCTCCATCGTTTACCGGTAAACCATCGCCAGGTGCAGCCTCAAAATTGAAGTCTCCACTCCCACCAAGACCTCCGTCTAATTCACACAAGCG...

Protein

Download Protein FASTA

1111 aa · TkA01G203420|TK1151|PROTEIN

MKRFIQPKSPILRENSVDTPPSNPTSVKQSKSSSRKKSPKENVAPSDPNAIPDSSPSPSFTGKPSPGAASKLKSPLPPRPPSNSHKRKLSNDFLLESCNAGSSDTGVKVIVRMRPPNLNEEEGEAIVQKTSGDSLSILGQTFTFDSVADATSTQVDIFQLVGAPLVENCIAGFNSSVFAYGQTGSGKTYTIWGPSNTSLEKELSSDQQGLTPRVFERLFSRINEEQDKHVDKQLMYQCRCSFLEIYNEQITDLLDPAQRN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G203420`
TK1151 ID	TkA01G203420
OH-1004 ID	LXL04_004099
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G203420

Location Chr01:51774034-51779308 (-)

Description Similar to KIN12A: Kinesin-like protein KIN-12A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23670`	Plus-end directed kinesin-like motor enzyme that plays a critical role in the organization of phragmoplast microtubules during cytokinesis.	Two Arabidopsis phragmoplast-associated kinesins play a critical role in cytokinesis during male gametogenesis.2007 · DOI: 10.1105/tpc.107.050716
`At4g14150`	Plus-end directed kinesin-like motor enzyme that plays a critical role in the organization of phragmoplast microtubules during cytokinesis.	Identification of a phragmoplast-associated kinesin-related protein in higher plants.2000 · DOI: 10.1016/s0960-9822(00)00564-9 Two Arabidopsis phragmoplast-associated kinesins play a critical role in cytokinesis during male gametogenesis.2007 · DOI: 10.1105/tpc.107.050716

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0350300`	Plus-end directed kinesin-like motor enzyme that plays a critical role in the organization of phragmoplast microtubules during cytokinesis.	No verified direct reference in this release
`Os02g0489800`	Kinesin-like protein KIN-12B.	No verified direct reference in this release
`Os03g0587200`	Kinesin-like protein KIN-12C.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004099 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0007112 male meiosis cytokinesis Biological Process

GO:0055046 microgametogenesis Biological Process

GO:0080175 phragmoplast microtubule organization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT3G23670

ath:AT4G14150

dosa:Os04g0350300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.641

Rank 1 · TkA01G203420 · TK1151

Nucleus0.319

Rank 2 · TkA01G203420 · TK1151

Cell membrane0.109

Rank 3 · TkA01G203420 · TK1151

Golgi apparatus0.062

Rank 4 · TkA01G203420 · TK1151

Mitochondrion0.045

Rank 5 · TkA01G203420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796Microtub_bd107-254 aa

PF00225Kinesin136-441 aa

PF25198Spore_GerAC_N248-274 aa

PF16796Microtub_bd817-924 aa

PF25198Spore_GerAC_N1053-1101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G203420	`PF16796`	Microtub_bd	107	254	7.1e-22	78.7
TkA01G203420	`PF00225`	Kinesin	136	441	2.7e-109	365.9
TkA01G203420	`PF25198`	Spore_GerAC_N	248	274	0.17	12.4
TkA01G203420	`PF16796`	Microtub_bd	817	924	7.1e-22	78.7
TkA01G203420	`PF25198`	Spore_GerAC_N	1053	1101	0.17	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7Y8`	Arabidopsis thaliana	sp\|Q8L7Y8\|KN12B_ARATH Kinesin-like protein KIN-12B	50.900%	Swiss-Prot	High
`Q9LDN0`	Arabidopsis thaliana	sp\|Q9LDN0\|KN12A_ARATH Kinesin-like protein KIN-12A	52.400%	Swiss-Prot	High
`Q7XKR9`	Oryza sativa subsp. japonica	sp\|Q7XKR9\|KN12A_ORYSJ Kinesin-like protein KIN-12A	49.600%	Swiss-Prot	Medium
`Q6K765`	Oryza sativa subsp. japonica	sp\|Q6K765\|KN12B_ORYSJ Kinesin-like protein KIN-12B	50.200%	Swiss-Prot	High
`Q5W6L9`	Oryza sativa subsp. japonica	sp\|Q5W6L9\|KN12C_ORYSJ Kinesin-like protein KIN-12C	34.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card