TkA01G202170 | RubberDandelionOmics

Gene overview

TkA01G202170

Reference: TK1151 Chr: Chr01 Coordinates: 51499654-51501200 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1379 bp · TkA01G202170|TK1151|cDNA

TAGGAAACACAAGACAATTCCATCCGCCACGTGGTAAACGTAACGCGCCACCTATATGTCCACCTTCACTGCCATCTGTAACACTACACAACTCAGCCACTCACCGCTCGACCTTTAAGACCCCCTCCATCAATCTCACCGGAGATATCCATCGCTGATTTTATCAGAAAAGCAAACGCATCCAAAATGCATCCCGTTAACGTACCACCCCACACTGAAATTCCCGGGGAGAAGACCCACCTCGGCACCTCCCTGGTCGA...

CDS

Download CDS FASTA

732 bp · TkA01G202170|TK1151|CDS

ATGCATCCCGTTAACGTACCACCCCACACTGAAATTCCCGGGGAGAAGACCCACCTCGGCACCTCCCTGGTCGACACCGCCGCCTCCTCGATCCAATCGTTCGGCCCAACTAAACAAATCCACCAACACCTCTGCGCGTTTCACTTTTACGCCGACGACATGACTCGACAAGTGGAAGCGCACCACTACTGCGGTCATCAAAACGATGAAATGCGACAGTGCCTGATCTACGACAGTCCCGACCCGGATGCCCGGTTAAT...

Protein

Download Protein FASTA

243 aa · TkA01G202170|TK1151|PROTEIN

MHPVNVPPHTEIPGEKTHLGTSLVDTAASSIQSFGPTKQIHQHLCAFHFYADDMTRQVEAHHYCGHQNDEMRQCLIYDSPDPDARLIGVEYIVTEELFLTLPDSEKPMWHSHEYEVKSGVLFLPGVPGPVERQDLEKVAKTYGKTIHFWQVDRGDQLPLGLPQVMMALTRDGQLYPNLAKDVESRYGVSYQKEKENRAYMEGPSQGIHPKANAGGIGLKTVMREVECKPSGHPTLEPIPRVFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G202170`
TK1151 ID	TkA01G202170
OH-1004 ID	LXL04_004106
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G202170

Location Chr01:51499654-51501200 (+)

Description Similar to OBAP1A: Oil body-associated protein 1A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05510`	Oil body-associated protein 1A.	No verified direct reference in this release
`At2g31985`	Oil body-associated protein 1B.	No verified direct reference in this release
`At5g45690`	Oil body-associated protein 2A.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004106 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0019915 lipid storage Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005811 lipid droplet Cellular Component

KEGG gene cross-reference

ath:AT1G05510

ath:AT2G31985

ath:AT5G45690

zma:100193701

zma:100274115

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.471

Rank 1 · TkA01G202170 · TK1151

Nucleus0.439

Rank 2 · TkA01G202170 · TK1151

Mitochondrion0.121

Rank 3 · TkA01G202170 · TK1151

Cell membrane0.070

Rank 4 · TkA01G202170 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA01G202170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06884DUF126434-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G202170	`PF06884`	DUF1264	34	200	4.7e-75	251.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVY7`	Arabidopsis thaliana	sp\|Q9ZVY7\|OBP1A_ARATH Oil body-associated protein 1A	68.700%	Swiss-Prot	High
`Q8GWR2`	Arabidopsis thaliana	sp\|Q8GWR2\|OBP1B_ARATH Oil body-associated protein 1B	65.100%	Swiss-Prot	High
`Q941A4`	Arabidopsis thaliana	sp\|Q941A4\|OBP2A_ARATH Oil body-associated protein 2A	41.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card