TkA01G194800 | RubberDandelionOmics

Gene overview

TkA01G194800

Reference: TK1151 Chr: Chr01 Coordinates: 49786758-49787260 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

359 bp · TkA01G194800|TK1151|cDNA

GGACTTAGAGTCGCTAGCCGTTCTTTTCCGGACAACAACGGGTCATTGTTCTCTTATGCATTGCGTCTATGGGGGCAAGGAGAATTATACAGGTTGAAGGATCCTTTGATGATGGAGGACAACCATGTTCGCAATGAACTGTCGAGGATTCTCAGGATATCCTTCCTGTGCATACAGACTAAACCAGATGACAGACCAAATGCGTCTACCATCTGTGAACTGCTCACGAATGACATGCCGGTGTCCGAGCCAGTTAGCCA...

CDS

Download CDS FASTA

348 bp · TkA01G194800|TK1151|CDS

GGACTTAGAGTCGCTAGCCGTTCTTTTCCGGACAACAACGGGTCATTGTTCTCTTATGCATTGCGTCTATGGGGGCAAGGAGAATTATACAGGTTGAAGGATCCTTTGATGATGGAGGACAACCATGTTCGCAATGAACTGTCGAGGATTCTCAGGATATCCTTCCTGTGCATACAGACTAAACCAGATGACAGACCAAATGCGTCTACCATCTGTGAACTGCTCACGAATGACATGCCGGTGTCCGAGCCAGTTAGCCA...

Protein

Download Protein FASTA

115 aa · TkA01G194800|TK1151|PROTEIN

GLRVASRSFPDNNGSLFSYALRLWGQGELYRLKDPLMMEDNHVRNELSRILRISFLCIQTKPDDRPNASTICELLTNDMPVSEPVSHRHLQVLMTPTSSSQDSVHTIEVGDHRIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G194800`
TK1151 ID	TkA01G194800
OH-1004 ID	LXL04_004156
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	65.300
Protein coverage (%)	TK1151 41.739 / OH-1004 16.279 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G194800

Location Chr01:49786758-49787260 (+)

Description Similar to CRK35: Putative cysteine-rich receptor-like protein kinase 35

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11470`	Putative cysteine-rich receptor-like protein kinase 31.	No verified direct reference in this release
`At4g11480`	Putative cysteine-rich receptor-like protein kinase 32.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004156 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0012501 programmed cell death Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0080136 priming of cellular response to stress Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G45860

ath:AT4G05200

ath:AT4G23230

ath:AT4G23310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.556

Rank 1 · TkA01G194800 · TK1151

Cytoplasm0.325

Rank 2 · TkA01G194800 · TK1151

Nucleus0.238

Rank 3 · TkA01G194800 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkA01G194800 · TK1151

Golgi apparatus0.051

Rank 5 · TkA01G194800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDM5`	Arabidopsis thaliana	sp\|Q9LDM5\|CRK31_ARATH Putative cysteine-rich receptor-like protein kinase 31	37.700%	Swiss-Prot	Medium
`Q9LDS6`	Arabidopsis thaliana	sp\|Q9LDS6\|CRK32_ARATH Putative cysteine-rich receptor-like protein kinase 32	36.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card