TkA01G193670 | RubberDandelionOmics

Gene overview

TkA01G193670

Reference: TK1151 Chr: Chr01 Coordinates: 49531674-49532262 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

516 bp · TkA01G193670|TK1151|cDNA

ATGTGCAAAAGCCGGGTGCATCGGATACATGAAGGGATGGTGTCCCCCAGAGCTCAAAGTGCAGGGTGGGGACGGATGCTGCAGTGCCTGCAATGTCTTTCATGCATCCTAAAACTGTTGCAGCGTGTCGTTCTCCACCCCCTCGACCTGCAAGCCGACAAGCTATGCAAAGGCCATCCAACGGATTACATCGTGAGGTTATGTCCGGCTGCCGGAAAATTCTCGATAATCCAAGTCGGCGAACAGCTCCGGTGTATAGA...

CDS

Download CDS FASTA

516 bp · TkA01G193670|TK1151|CDS

ATGTGCAAAAGCCGGGTGCATCGGATACATGAAGGGATGGTGTCCCCCAGAGCTCAAAGTGCAGGGTGGGGACGGATGCTGCAGTGCCTGCAATGTCTTTCATGCATCCTAAAACTGTTGCAGCGTGTCGTTCTCCACCCCCTCGACCTGCAAGCCGACAAGCTATGCAAAGGCCATCCAACGGATTACATCGTGAGGTTATGTCCGGCTGCCGGAAAATTCTCGATAATCCAAGTCGGCGAACAGCTCCGGTGTATAGA...

Protein

Download Protein FASTA

171 aa · TkA01G193670|TK1151|PROTEIN

MCKSRVHRIHEGMVSPRAQSAGWGRMLQCLQCLSCILKLLQRVVLHPLDLQADKLCKGHPTDYIVRLCPAAGKFSIIQVGEQLRCIDRLTFRNGTFTLGFYGVHFGSLGIWYSNDENNKVWIAEPTLSTSGNHVFSIDPNTRSLIIIAGDSTLRVIADVRNGPSSNVIVSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G193670`
TK1151 ID	TkA01G193670
OH-1004 ID	LXL04_004154
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	71.700
Protein coverage (%)	TK1151 66.082 / OH-1004 29.737 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G193670`
Location	Chr01:49531674-49532262 (-)
Description	Similar to SRK6: Putative serine/threonine-protein kinase receptor
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004154` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006955 immune response Biological Process GO:0007165 signal transduction Biological Process GO:0048544 recognition of pollen Biological Process GO:0060320 rejection of self pollen Biological Process GO:0005773 vacuole Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009506 plasmodesma Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	ath:AT4G21380 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.286

Rank 1 · TkA01G193670 · TK1151

Extracellular0.245

Rank 2 · TkA01G193670 · TK1151

Cytoplasm0.198

Rank 3 · TkA01G193670 · TK1151

Endoplasmic reticulum0.186

Rank 4 · TkA01G193670 · TK1151

Nucleus0.162

Rank 5 · TkA01G193670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24498Ig_TMEM131L_3106-149 aa

PF24723DUF7675111-138 aa

PF21828DUF6888133-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G193670	`PF24498`	Ig_TMEM131L_3	106	149	0.27	12.0
TkA01G193670	`PF24723`	DUF7675	111	138	0.077	13.6
TkA01G193670	`PF21828`	DUF6888	133	152	0.23	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card