Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1653 bp · TkA01G185090|TK1151|cDNA
ATCAAAACCAACTCCAGCCCCAAAACCCAAACACAGCATGAATCTCTCCTCCCCCGTATGGCGTCACCACTCTCCTCCGTCATCGCCGGAAAACTTAATTTTAAATATCAAAGGTCTTAAACTCCTAGCAACCCGATTAATTCGATTCTTCTTACCAGGAAAATATTGGATGTTATAATCTTTGGAATCACGCCCTTTAACTCCACTCCAGTTCGATCATTGTAAGTTCTTAGGAGGAGACAGAAAGGCCTATGATGCGA...
867 bp · TkA01G185090|TK1151|CDS
ATGGTGGAGCAAGGTCAACAAATTACAGAATCTGTGTCCATTCCAGTGATCGGCGATGGTGATAATGGATACGGAAACGCCATGAACATGAAGAGAACTGTGAAAGGATACATCAAAGCAGGATTTGCAGGAATCATCCTGGAAGATCAGGTGTCCCCAAAAGCTTGTGGTCATACACAAGGCAGGAAAGTCCTATCCAGAGAAGAAGCTGTGATGAAGATAAAAGCAGCTGTTGATGCTCGGAAGGAGAGTGGTTCCGA...
Protein
Download Protein FASTA288 aa · TkA01G185090|TK1151|PROTEIN
MVEQGQQITESVSIPVIGDGDNGYGNAMNMKRTVKGYIKAGFAGIILEDQVSPKACGHTQGRKVLSREEAVMKIKAAVDARKESGSDIVIVARTDSRQALSLEEALWRSRAFADAGADVLFIDALASKEEMKSFCEISPGVPKMANMLEGGGKTPILTPLELEEIGYKLIAYPLSLLGVSIRAMDDALVAIKGGRVPSPASMPSFEEVKEILGFNTYYEEEKRYATKTSQPVWQTGGSNQYGIRKWGADDKEQKGEEPYE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G185090 |
|---|---|
| TK1151 ID | TkA01G185090 |
| OH-1004 ID | LXL04_004202 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 95.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 60.759Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G185090 |
|---|---|
| Location | Chr01:47488782-47490961 (-) |
| Description | Similar to Dml: 2,3-dimethylmalate lyase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006107 oxaloacetate metabolic process Biological Process GO:0017000 antibiotic biosynthetic process Biological Process GO:0019629 propionate catabolic process, 2-methylcitrate cycle Biological Process GO:1901848 nicotinate catabolic process Biological Process GO:0009507 chloroplast Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0008807 carboxyvinyl-carboxyphosphonate phosphorylmutase activity Molecular Function GO:0016740 transferase activity Molecular Function GO:0016829 lyase activity Molecular Function GO:0016833 oxo-acid-lyase activity Molecular Function GO:0030603 oxaloacetase activity Molecular Function |
| KEGG gene cross-reference | ag:ABC88406 ag:CAA48139 ape:APE_0222.1 ath:AT1G77060 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13714PEP_mutase2-191 aaPF00463ICL14-100 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G185090 | PF13714 | PEP_mutase | 2 | 191 | 5.7e-35 | 121.7 |
| TkA01G185090 | PF00463 | ICL | 14 | 100 | 2.8e-12 | 46.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.