TkA01G183050 | RubberDandelionOmics

Gene overview

TkA01G183050

Reference: TK1151 Chr: Chr01 Coordinates: 46982979-46985507 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1114 bp · TkA01G183050|TK1151|cDNA

GATATTTGCTGACATAATGCGAGATTAATTCAGAAGGCAAAAACTAAGAAGAAAAGGGCGAAAGGTGGGAGGAGGAATCAACTGTAAAAATATTGGGAGATCGAGAAAGTGAGCAAGGAGAAATATGATCGGCGACGTTGCTGCTAATTCACCTTCTAATGCCGCCGAAGGGACACCGGAGAACCAGCAGCCAGAAAAGCCGTGGCATTCCTACATTTATGAGGACCTGCCTCGTACGGTACAAGAATCTGCCGATTCCG...

CDS

Download CDS FASTA

744 bp · TkA01G183050|TK1151|CDS

ATGATCGGCGACGTTGCTGCTAATTCACCTTCTAATGCCGCCGAAGGGACACCGGAGAACCAGCAGCCAGAAAAGCCGTGGCATTCCTACATTTATGAGGACCTGCCTCGTACGGTACAAGAATCTGCCGATTCCGCCGTTCGCTCCGCCCGCTCGCTGCAGCATAATTCGTCCACTCAAATTCGAACTCTCCAGGATAATGTAGTTCAATACACAGCACAGTATAGGAGTTATGAAGACCTGGCCTTCAATAAGATCAA...

Protein

Download Protein FASTA

247 aa · TkA01G183050|TK1151|PROTEIN

MIGDVAANSPSNAAEGTPENQQPEKPWHSYIYEDLPRTVQESADSAVRSARSLQHNSSTQIRTLQDNVVQYTAQYRSYEDLAFNKIKEQITIAREHSALSAGIAITTALLLMRGPRRFLFRRTLGRFQTEEAQIVKAGNNVNHLTISVQLMKKESEKLLERAALAEKEMTYGYGELRNAGGQIKSLAKSVHKAETQAKDILDDLREIPGRDALRLRGEVANMASSLKEKRLAMNKRIMRISDLGIRV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G183050`
TK1151 ID	TkA01G183050
OH-1004 ID	LXL04_004216
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G183050

Location Chr01:46982979-46985507 (+)

Description Similar to RHIP1: RGS1-HXK1-interacting protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26410`	Required for some glucose-regulated gene expression, being a physical connection between RGS1 and HXK1 in sugar signaling.	Cooperative control between AtRGS1 and AtHXK1 in a WD40-repeat protein pathway in Arabidopsis thaliana.2015 · DOI: 10.3389/fpls.2015.00851

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004216 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0071333 cellular response to glucose stimulus Biological Process

GO:1902659 regulation of glucose mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT4G26410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.878

Rank 1 · TkA01G183050 · TK1151

Cytoplasm0.087

Rank 2 · TkA01G183050 · TK1151

Nucleus0.075

Rank 3 · TkA01G183050 · TK1151

Plastid0.034

Rank 4 · TkA01G183050 · TK1151

Cell membrane0.028

Rank 5 · TkA01G183050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27724RHIP136-247 aa

PF27241CLIP137-74 aa

PF09747CCD97-like_C45-45 aa

PF30679CCDC18_2nd48-96 aa

PF30677CCDC18_1st52-71 aa

PF00261Tropomyosin57-71 aa

PF13166AAA_1357-75 aa

PF09747CCD97-like_C118-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G183050	`PF27724`	RHIP1	36	247	2.2e-72	244.4
TkA01G183050	`PF27241`	CLIP1	37	74	0.27	12.0
TkA01G183050	`PF09747`	CCD97-like_C	45	45	0.033	15.0
TkA01G183050	`PF30679`	CCDC18_2nd	48	96	0.17	10.7
TkA01G183050	`PF30677`	CCDC18_1st	52	71	0.14	12.1
TkA01G183050	`PF00261`	Tropomyosin	57	71	0.041	14.0
TkA01G183050	`PF13166`	AAA_13	57	75	0.89	8.9
TkA01G183050	`PF09747`	CCD97-like_C	118	184	0.033	15.0
TkA01G183050	`PF30679`	CCDC18_2nd	131	245	0.17	10.7
TkA01G183050	`PF27241`	CLIP1	132	207	0.27	12.0
TkA01G183050	`PF30677`	CCDC18_1st	134	231	0.14	12.1
TkA01G183050	`PF00261`	Tropomyosin	141	207	0.041	14.0
TkA01G183050	`PF13166`	AAA_13	141	225	0.89	8.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84K90`	Arabidopsis thaliana	sp\|Q84K90\|RHIP1_ARATH RGS1-HXK1-interacting protein 1	58.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card