TkA01G182770 | RubberDandelionOmics

Gene overview

TkA01G182770

Reference: TK1151 Chr: Chr01 Coordinates: 46910606-46912467 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1700 bp · TkA01G182770|TK1151|cDNA

TACTACGGCGTCAGTTCAAATTTAATCACATACTTGACAGGACCCTTGGGGCAATCGACGTCCACCGCCGCCAAGAATGTCAACGTGTGGTCTGGAATAACGAAGCTTCTACCTCTTTTTGGCGCTTTCATTGCCGATGCTTTTCTTGGTCGATACCTCACGATTATAATTGCTTCTCTCATCTATGTTCTGGCACTTGCGTTTCTGGCTCTTTCCACTTTGATTCCTTCAAACTGTGATGAAACGGGGAATATTGGTTC...

CDS

Download CDS FASTA

1566 bp · TkA01G182770|TK1151|CDS

TACTACGGCGTCAGTTCAAATTTAATCACATACTTGACAGGACCCTTGGGGCAATCGACGTCCACCGCCGCCAAGAATGTCAACGTGTGGTCTGGAATAACGAAGCTTCTACCTCTTTTTGGCGCTTTCATTGCCGATGCTTTTCTTGGTCGATACCTCACGATTATAATTGCTTCTCTCATCTATGTTCTGGCACTTGCGTTTCTGGCTCTTTCCACTTTGATTCCTTCAAACTGTGATGAAACGGGGAATATTGGTTC...

Protein

Download Protein FASTA

521 aa · TkA01G182770|TK1151|PROTEIN

YYGVSSNLITYLTGPLGQSTSTAAKNVNVWSGITKLLPLFGAFIADAFLGRYLTIIIASLIYVLALAFLALSTLIPSNCDETGNIGSSSTCSSFSSQLQVILFFISLYLVAFAQGGHKPCVQAFGADQFDADDPQERKAKNSFFNWWYFGLSVGPTVGIFVVSYIQDNFSWGLGFGIPCIIMVFSLIIFLFGTITYRFGEKKEEKSGFLRISQVFVKAAKNWHTTTTSRISSQEEGCRILHHQDSQQFRFLDKALFDESH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G182770`
TK1151 ID	TkA01G182770
OH-1004 ID	LXL04_031830
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	80.500
Protein coverage (%)	TK1151 99.232 / OH-1004 40.349 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G182770

Location Chr01:46910606-46912467 (+)

Description Similar to NPF5.10: Protein NRT1/ PTR FAMILY 5.10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22540`	Protein NRT1/ PTR FAMILY 5.10.	No verified direct reference in this release
`At1g72120`	Protein NRT1/ PTR FAMILY 5.14.	No verified direct reference in this release
`At1g72125`	Protein NRT1/ PTR FAMILY 5.13.	No verified direct reference in this release
`At1g72140`	Protein NRT1/ PTR FAMILY 5.12.	No verified direct reference in this release
`At1g22550`	Protein NRT1/ PTR FAMILY 5.16.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031830 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

GO:0042937 tripeptide transmembrane transporter activity Molecular Function

GO:0071916 dipeptide transmembrane transporter activity Molecular Function

GO:0080054 low-affinity nitrate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G22540

ath:AT1G72125

ath:AT1G72140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.631

Rank 1 · TkA01G182770 · TK1151

Lysosome / Vacuole0.143

Rank 2 · TkA01G182770 · TK1151

Endoplasmic reticulum0.103

Rank 3 · TkA01G182770 · TK1151

Cytoplasm0.070

Rank 4 · TkA01G182770 · TK1151

Golgi apparatus0.040

Rank 5 · TkA01G182770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_111-455 aa

PF00854PTR252-474 aa

PF07690MFS_1403-503 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G182770	`PF07690`	MFS_1	11	455	3.9e-13	49.8
TkA01G182770	`PF00854`	PTR2	52	474	6.6e-92	309.1
TkA01G182770	`PF07690`	MFS_1	403	503	3.9e-13	49.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WP01`	Arabidopsis thaliana	sp\|Q0WP01\|PTR9_ARATH Protein NRT1/ PTR FAMILY 5.10	59.700%	Swiss-Prot	High
`Q8VZE2`	Arabidopsis thaliana	sp\|Q8VZE2\|PTR22_ARATH Protein NRT1/ PTR FAMILY 5.14	53.600%	Swiss-Prot	High
`Q0WSZ6`	Arabidopsis thaliana	sp\|Q0WSZ6\|PTR23_ARATH Protein NRT1/ PTR FAMILY 5.13	52.900%	Swiss-Prot	High
`Q9C7U1`	Arabidopsis thaliana	sp\|Q9C7U1\|PTR25_ARATH Protein NRT1/ PTR FAMILY 5.12	51.800%	Swiss-Prot	High
`Q9SK96`	Arabidopsis thaliana	sp\|Q9SK96\|PTR10_ARATH Protein NRT1/ PTR FAMILY 5.16	52.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card