TkA01G182700 | RubberDandelionOmics

Gene overview

TkA01G182700

Reference: TK1151 Chr: Chr01 Coordinates: 46883672-46885826 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1633 bp · TkA01G182700|TK1151|cDNA

CATCACTCCACCACTTTATTTTCTTGCCATATGAGACTTTAAATTCATTAAAGGCTCCTGGCCGTCGACCACTCGCCCCCGCTAAATCATCGTTGAGCCACAAGTCCCAACGTAGAAGATCCTGTCGTTGAGCCACATACCCTTAATTTAAACCTGCCTGTCTCACAACTTCTATATACCATCGACGACACACACATCCTGTCGCCTCTCACTCTCCTCCCCCTGCTCACTGTTGTCTCCCTCTCCTGTGACGCCTGGCG...

CDS

Download CDS FASTA

1008 bp · TkA01G182700|TK1151|CDS

ATGAAGGAAGAAGAAGTAAACAGATGCCAAATCCAAGAATGGTACCCAACATTCAAATCCACAACCATAAAAACAATAATCCACCCACTCCCGGAATCCTTCATCCACTACCTCCTCGATGATTCCGGTCCTTTCCTCCTCCCACTTTCCATCTCCAATTCCGACCCCTTACCCAACAGAATCCCCAATTCCGAACACCACCAAGACTTCACCATCCCAAACCACCAAGAATCCGACGACGAATCCGAACAACCACCACC...

Protein

Download Protein FASTA

335 aa · TkA01G182700|TK1151|PROTEIN

MKEEEVNRCQIQEWYPTFKSTTIKTIIHPLPESFIHYLLDDSGPFLLPLSISNSDPLPNRIPNSEHHQDFTIPNHQESDDESEQPPPPPSFPQLESQINQSIAALGGSIFPKLNWTSPKDSSWISPTGTLKCTSFTEIVLLLKSSDSLVHDLCHAYDLCNDRTAPPRPDCFFLALRKWYPSLHPEMEFRCFVRNGNLVGISQREVTGFYPVLIERKRELESGITEFYEGKVRGRFESERYTFDVYVRADGEVKLLDFNTW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G182700`
TK1151 ID	TkA01G182700
OH-1004 ID	LXL04_004219
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G182700`
Location	Chr01:46883672-46885826 (+)
Description	Similar to Cdc123: Cell division cycle protein 123 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004219` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0051301 cell division Biological Process GO:1905143 eukaryotic translation initiation factor 2 complex assembly Biological Process GO:0005737 cytoplasm Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0005524 ATP binding Molecular Function GO:0044183 protein folding chaperone Molecular Function
KEGG gene cross-reference	hsa:8872 mmu:98828 nve:5521954 rno:116656 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.791

Rank 1 · TkA01G182700 · TK1151

Cytoplasm0.521

Rank 2 · TkA01G182700 · TK1151

Mitochondrion0.028

Rank 3 · TkA01G182700 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA01G182700 · TK1151

Cell membrane0.020

Rank 5 · TkA01G182700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07065D12314-309 aa

PF14243R2K_3184-258 aa

PF18299R2K_2185-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G182700	`PF07065`	D123	14	309	2.5e-92	310.0
TkA01G182700	`PF14243`	R2K_3	184	258	0.0011	19.9
TkA01G182700	`PF18299`	R2K_2	185	258	0.036	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card