TkA01G175130 | RubberDandelionOmics

Gene overview

TkA01G175130

Reference: TK1151 Chr: Chr01 Coordinates: 44895365-44898560 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2047 bp · TkA01G175130|TK1151|cDNA

ATTTGAGACAAGCTGTTCTGTTTTCCTCTTCTGAAAGTTCCCAATTTAATTCTCACTCACTGTCACTCCTTCGTAAATGTTAAATGTGGCTTTGGATTCTTTCTTAGATTTCGTTTTACTTATTCTTCATTTACTGAAAGCTTAGCTTGCTGACGAACTTCAAAACTACAGCTCTCTTTGGTGGTATCTTCAAGAACTAGGGTACAGGGGTGAAAGCTCATGGTGAAGATTGGAGTCAAATCGTCCATTGGAAGGATGAG...

CDS

Download CDS FASTA

1512 bp · TkA01G175130|TK1151|CDS

ATGGTGAAGATTGGAGTCAAATCGTCCATTGGAAGGATGAGGCTTCAAATGTTGCTTGGATATGTCCTTTTTATTTTCAGCAGTTTGTCAGTTGCATTAGGGGCTTTTGTGGGAATAAACATCGGAACGGATCTTTCCACCCTCCCATCACCGGAACAAGTAGTGGCAATCCTTCGATCCCATCAAATAACACACATCCGCCTTTTCGATTCCGACAACCACCTACTCAGTGCACTTTCCGACACCGGAATCGAAGTCAT...

Protein

Download Protein FASTA

503 aa · TkA01G175130|TK1151|PROTEIN

MVKIGVKSSIGRMRLQMLLGYVLFIFSSLSVALGAFVGINIGTDLSTLPSPEQVVAILRSHQITHIRLFDSDNHLLSALSDTGIEVMVSVTNDEVLRIGQTPSAAASWINKNVAAFVPATNITAIAVGSEVLSTIPNVAPVLVPAMYNLHKALVSSNLNYKIQVSTPLSMDLIPRPFPPSAALFNSSWNTTIDGILKFLKTTNSVFMLNAYPYYGYVQSSGIFPIEYALFRQLSPVKQIVDPNTLFHYDSMFDAMVDATY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G175130`
TK1151 ID	TkA01G175130
OH-1004 ID	LXL04_004277
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G175130

Location Chr01:44895365-44898560 (-)

Description Similar to At3g13560: Glucan endo-1,3-beta-glucosidase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13560`	Glucan endo-1,3-beta-glucosidase 4.	No verified direct reference in this release
`At2g01630`	Glucan endo-1,3-beta-glucosidase 3.	No verified direct reference in this release
`At1g66250`	Glucan endo-1,3-beta-glucosidase 2.	No verified direct reference in this release
`At1g11820`	Glucan endo-1,3-beta-glucosidase 1.	No verified direct reference in this release
`At5g56590`	Glucan endo-1,3-beta-glucosidase 13.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004277 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT1G11820

ath:AT1G66250

ath:AT2G01630

ath:AT3G13560

ath:AT5G56590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.613

Rank 1 · TkA01G175130 · TK1151

Extracellular0.127

Rank 2 · TkA01G175130 · TK1151

Endoplasmic reticulum0.094

Rank 3 · TkA01G175130 · TK1151

Cytoplasm0.075

Rank 4 · TkA01G175130 · TK1151

Lysosome / Vacuole0.060

Rank 5 · TkA01G175130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332Glyco_hydro_1737-356 aa

PF29664BtgE-BtgC_glyc-hydro55-167 aa

PF29664BtgE-BtgC_glyc-hydro254-342 aa

PF07983X8374-443 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G175130	`PF00332`	Glyco_hydro_17	37	356	6.8e-74	250.0
TkA01G175130	`PF29664`	BtgE-BtgC_glyc-hydro	55	167	1.5e-12	48.0
TkA01G175130	`PF29664`	BtgE-BtgC_glyc-hydro	254	342	1.5e-12	48.0
TkA01G175130	`PF07983`	X8	374	443	1e-18	68.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CD8`	Arabidopsis thaliana	sp\|Q94CD8\|E134_ARATH Glucan endo-1,3-beta-glucosidase 4	61.100%	Swiss-Prot	High
`Q9ZU91`	Arabidopsis thaliana	sp\|Q9ZU91\|E133_ARATH Glucan endo-1,3-beta-glucosidase 3	50.800%	Swiss-Prot	High
`Q9C7U5`	Arabidopsis thaliana	sp\|Q9C7U5\|E132_ARATH Glucan endo-1,3-beta-glucosidase 2	51.700%	Swiss-Prot	High
`O65399`	Arabidopsis thaliana	sp\|O65399\|E131_ARATH Glucan endo-1,3-beta-glucosidase 1	48.300%	Swiss-Prot	Medium
`Q9FJU9`	Arabidopsis thaliana	sp\|Q9FJU9\|E1313_ARATH Glucan endo-1,3-beta-glucosidase 13	39.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card