TkA01G175060 | RubberDandelionOmics

Gene overview

TkA01G175060

Reference: TK1151 Chr: Chr01 Coordinates: 44869545-44871642 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

937 bp · TkA01G175060|TK1151|cDNA

TTCAAGTTTAAACCAACTCACCGTAGTTTTGACTTTACAAAGTGGTTTGACCCTCTAATTGGGGTTTTTTTTCATGGTTCAGATCGAACTCAAAGTAGTTTTGACTTCACAAAGATCACCGGTTCTTCCCTCCCACAATTTTCATCGGATTTCCCTAAGAATTGGAGGCGGATGAATGATGATGAACAGTGGGAGCTTGAGTGGTGGGCGATCATGGCCGTCACGGACATCTCTAACCTCGTCGGGGAAGAGGATACAGA...

CDS

Download CDS FASTA

510 bp · TkA01G175060|TK1151|CDS

ATGATGATGAACAGTGGGAGCTTGAGTGGTGGGCGATCATGGCCGTCACGGACATCTCTAACCTCGTCGGGGAAGAGGATACAGAAGGAGATGGCAGAACTCACCACTGACCCACCTGCCGATTGTTCCGCTGGTCCCAAAGGCGATAACCTTTATCACTGGGTCGCTACTCTCTTCGGTCCCCAAGGTACGCCTTACGAAGGAGGCATATACTTTCTTGACATAACATTTCCTGCTAATTATCCTTTTAAACCTCCAAA...

Protein

Download Protein FASTA

169 aa · TkA01G175060|TK1151|PROTEIN

MMMNSGSLSGGRSWPSRTSLTSSGKRIQKEMAELTTDPPADCSAGPKGDNLYHWVATLFGPQGTPYEGGIYFLDITFPANYPFKPPKVVFKTRIYHCNVDLTGNVSLDILEENSWSPALTISKVLLALRLIFTNPNPYKPQVPGIAHLYLVDRSKHDELAAEWTQRFAK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G175060`
TK1151 ID	TkA01G175060
OH-1004 ID	LXL04_004280
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G175060

Location Chr01:44869545-44871642 (-)

Description Similar to COP10: Constitutive photomorphogenesis protein 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13550`	Component of light signal transduction machinery.	Arabidopsis COP10 is a ubiquitin-conjugating enzyme variant that acts together with COP1 and the COP9 signalosome in repressing photomorphogenesis.2002 · DOI: 10.1101/gad.964602 Arabidopsis COP10 forms a complex with DDB1 and DET1 in vivo and enhances the activity of ubiquitin conjugating enzymes.2004 · DOI: 10.1101/gad.1229504

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004280 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006513 protein monoubiquitination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0032020 ISG15-protein conjugation Biological Process

GO:0070534 protein K63-linked ubiquitination Biological Process

GO:0070936 protein K48-linked ubiquitination Biological Process

GO:0070979 protein K11-linked ubiquitination Biological Process

GO:1900087 positive regulation of G1/S transition of mitotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G13550

bta:534349

hsa:10477

hsa:7325

mmu:22193

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.531

Rank 1 · TkA01G175060 · TK1151

Nucleus0.512

Rank 2 · TkA01G175060 · TK1151

Cell membrane0.102

Rank 3 · TkA01G175060 · TK1151

Endoplasmic reticulum0.061

Rank 4 · TkA01G175060 · TK1151

Golgi apparatus0.050

Rank 5 · TkA01G175060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179UQ_con26-163 aa

PF05743UEV63-138 aa

PF05773RWD73-92 aa

PF05773RWD113-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G175060	`PF00179`	UQ_con	26	163	2.1e-44	151.2
TkA01G175060	`PF05743`	UEV	63	138	0.0055	17.1
TkA01G175060	`PF05773`	RWD	73	92	0.041	14.8
TkA01G175060	`PF05773`	RWD	113	145	0.041	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJD7`	Arabidopsis thaliana	sp\|Q9LJD7\|COP10_ARATH Constitutive photomorphogenesis protein 10	71.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card