Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2599 bp · TkA01G174920|TK1151|cDNA
GTTTTGCTTGCCGTTCAAAAAACAATTTCCACAAGACAAAAATCATAATTTCGTGAACACATCCGATATCTAAAATTGTTCCGATGAACATGGTAACAATTTCATGGTTGAAAAGAGTGACAGACGCACCCTACTCAATCTCAAATCTCAATCACAGCATGAATCACCTACCCCTAATCCCTACTTTTAAGCCCTTCATGTTTGGAACTCAGAGAAAATGGAAATTCAGATGGCTAAACCTAAACGTATCCAAGAATTGG...
2295 bp · TkA01G174920|TK1151|CDS
ATGGAAATTCAGATGGCTAAACCTAAACGTATCCAAGAATTGGGACTCCAAGAACTACTGAATACTGGGTTATCATCACATGATGCGAAATCGCTGCATATCGAGCTTAAAGAAGCCATTCACCGCACCACTAGCTCCAGTCCAGTTGAGTTATGGCGCGACATCACTTCTCGAAGGTTGCTCAGACCATCTTACCCTCATTCTCTTCACCGGCTCATCTACAACGCGGTTTATGCTGATTACGATGCCTCCGTCCATGG...
Protein
Download Protein FASTA764 aa · TkA01G174920|TK1151|PROTEIN
MEIQMAKPKRIQELGLQELLNTGLSSHDAKSLHIELKEAIHRTTSSSPVELWRDITSRRLLRPSYPHSLHRLIYNAVYADYDASVHGPAPYWFPSDVNGTETNLGRLLETHGSKLLGAAYKDPITSFKQFQKFSVQHPDAYWSIVLEELSVRFHQPPRCILDTSNKSKHNGTWFPDSVLNIAECCLKPNTKHDNGIERVAIVWRDARFDNFEVNKMTLNELRHQVMVVANSLKGLFSKGDPIAIDMPMTVTAVILYLAII...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G174920 |
|---|---|
| TK1151 ID | TkA01G174920 |
| OH-1004 ID | LXL04_004281 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 89.500 |
| Protein coverage (%) | TK1151 99.869 / OH-1004 99.866Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G174920 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:44827126-44831098 (-) | |||||||||
| Description | Similar to AAE18: Probable acyl-activating enzyme 18, peroxisomal | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006631 fatty acid metabolic process Biological Process GO:0006935 chemotaxis Biological Process GO:0009850 auxin metabolic process Biological Process GO:0016114 terpenoid biosynthetic process Biological Process GO:0019427 acetyl-CoA biosynthetic process from acetate Biological Process GO:0046949 fatty-acyl-CoA biosynthetic process Biological Process GO:1901696 cannabinoid biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005777 peroxisome Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G55320 ath:AT5G23050 stt:t4181 sty:STY4473 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF27750SAM_AAE17_189-79 aaPF16177ACAS_N80-92 aaPF16177ACAS_N128-185 aaPF00501AMP-binding197-548 aaPF03321GH3362-386 aaPF13193AMP-binding_C677-744 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G174920 | PF27750 | SAM_AAE17_18 | 9 | 79 | 1.2e-15 | 58.3 |
| TkA01G174920 | PF16177 | ACAS_N | 80 | 92 | 2.4e-09 | 37.6 |
| TkA01G174920 | PF16177 | ACAS_N | 128 | 185 | 2.4e-09 | 37.6 |
| TkA01G174920 | PF00501 | AMP-binding | 197 | 548 | 1.5e-31 | 110.3 |
| TkA01G174920 | PF03321 | GH3 | 362 | 386 | 0.028 | 14.3 |
| TkA01G174920 | PF13193 | AMP-binding_C | 677 | 744 | 8.2e-05 | 24.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.