TkA01G169380 | RubberDandelionOmics

Gene overview

TkA01G169380

Reference: TK1151 Chr: Chr01 Coordinates: 43443031-43444246 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

504 bp · TkA01G169380|TK1151|cDNA

ATGACGATCGGAATAATGGAGGTGAACGTGGTGGATGCTCGTGGTCTTAAAAAGTCCGATTTACTCAACAAAATAGATCCATATGTGTTGGTCCAATACAGAAGTCAAGAGCACAAGAGCTTAATTGCCAAAGGGCAAGGCAGCAACCCAAAATGGAACCAAAAATTCACATTTAGGGTAGAATACCCAGGAGCAGACGATCAACCTAAGCTTGTTCTCAAGATTATGGATCATGATACCTTCTCATCTGACGATTCCAT...

CDS

Download CDS FASTA

504 bp · TkA01G169380|TK1151|CDS

ATGACGATCGGAATAATGGAGGTGAACGTGGTGGATGCTCGTGGTCTTAAAAAGTCCGATTTACTCAACAAAATAGATCCATATGTGTTGGTCCAATACAGAAGTCAAGAGCACAAGAGCTTAATTGCCAAAGGGCAAGGCAGCAACCCAAAATGGAACCAAAAATTCACATTTAGGGTAGAATACCCAGGAGCAGACGATCAACCTAAGCTTGTTCTCAAGATTATGGATCATGATACCTTCTCATCTGACGATTCCAT...

Protein

Download Protein FASTA

167 aa · TkA01G169380|TK1151|PROTEIN

MTIGIMEVNVVDARGLKKSDLLNKIDPYVLVQYRSQEHKSLIAKGQGSNPKWNQKFTFRVEYPGADDQPKLVLKIMDHDTFSSDDSIGQTTIHLKEVFEYGVENGSSELRLQKYRVVDSSQSYSGDIRVGITFTPRVETEYYAQKIGGWKESQRMISLEVLKFEEEK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G169380`
TK1151 ID	TkA01G169380
OH-1004 ID	LXL04_012366
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G169380

Location Chr01:43443031-43444246 (-)

Description Similar to PP16-1: 16 kDa phloem protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55470`	Binds to both sense and antisense RNA.	Solution NMR Structure and Backbone Dynamics of Partially Disordered Arabidopsis thaliana Phloem Protein 16-1, a Putative mRNA Transporter.2018 · DOI: 10.1021/acs.biochem.7b01071

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WWV5`	May play a role in plant defense signaling.	No verified direct reference in this release
`Os01g0841700`	May play a role in plant defense signaling (Probable).	Rice C2-domain proteins are induced and translocated to the plasma membrane in response to a fungal elicitor.2003 · DOI: 10.1021/bi034576n
`UniProt: Q25AG5`	Elicitor-responsive protein 3.	No verified direct reference in this release
`Os04g0531100`	May play a role in plant defense signaling (Probable).	Rice OsERG3 encodes an unusual small C2-domain protein containing a Ca(2+)-binding module but lacking phospholipid-binding properties.2011 · DOI: 10.1016/j.bbagen.2011.06.021

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012366 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0005544 calcium-dependent phospholipid binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G55470

dosa:Os01g0841700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.388

Rank 1 · TkA01G169380 · TK1151

Cytoplasm0.385

Rank 2 · TkA01G169380 · TK1151

Nucleus0.226

Rank 3 · TkA01G169380 · TK1151

Endoplasmic reticulum0.105

Rank 4 · TkA01G169380 · TK1151

Lysosome / Vacuole0.104

Rank 5 · TkA01G169380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C25-106 aa

PF00792PI3K_C242-119 aa

PF07162B9-C244-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G169380	`PF00168`	C2	5	106	1.5e-22	80.5
TkA01G169380	`PF00792`	PI3K_C2	42	119	0.15	12.7
TkA01G169380	`PF07162`	B9-C2	44	117	0.0025	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2T2`	Arabidopsis thaliana	sp\|Q9M2T2\|PP16A_ARATH 16 kDa phloem protein 1	48.700%	Swiss-Prot	Medium
`A2WWV5`	Oryza sativa subsp. indica	sp\|A2WWV5\|ERG1_ORYSI Elicitor-responsive protein 1	47.400%	Swiss-Prot	Medium
`Q0JHU5`	Oryza sativa subsp. japonica	sp\|Q0JHU5\|ERG1_ORYSJ Elicitor-responsive protein 1	47.400%	Swiss-Prot	Medium
`Q25AG5`	Oryza sativa subsp. indica	sp\|Q25AG5\|ERG3_ORYSI Elicitor-responsive protein 3	38.300%	Swiss-Prot	Medium
`Q0JBH9`	Oryza sativa subsp. japonica	sp\|Q0JBH9\|ERG3_ORYSJ Elicitor-responsive protein 3	38.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card