TkA01G168020 | RubberDandelionOmics

Gene overview

TkA01G168020

Reference: TK1151 Chr: Chr01 Coordinates: 43053609-43058094 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1499 bp · TkA01G168020|TK1151|cDNA

TTTCCTGCCACGAATCCGTTTCTCGATCCTTCCTCCCTGGGAATCCTTCCTCACCTTGCTCGATCAAAAAAATCTGCCCCTTTTCTCTTCCAGTTTATTCCACTGTGTCTATCGAAACCTTAGCAAAGATCGCCAAATTAATCGAAGAAGATGGTCAATAAACGAGTTCCCGATTGGCTCGACAATTCCATGTGGTCTGCACCCACCACCAGCACTCCTTCACCACCTAAATCGCAATCTCAATCTTCGCCGTCTCAATC...

CDS

Download CDS FASTA

750 bp · TkA01G168020|TK1151|CDS

ATGGAGCTAAAGTTTGTTATGGAATCAGAAAGGAATCAGGGGTCTGTTTTGAAAGCTATATTACAAGCAAAATCTTCCAGTTCAATTCAGGGTATTTATGGAAGAATGGGTGACTTGGGTGCTATTGATGCAAAGTATGACGTGGCAGTTTCAACAGCATGTGGTGGAATTGATTATATTGTGGTGGAAACAACTGCTGCAGCTCAAGCATGTGTGGCCATGCTTCGAAAGAACAATCTTGGTGTTGCCACTTTCATGAT...

Protein

Download Protein FASTA

249 aa · TkA01G168020|TK1151|PROTEIN

MELKFVMESERNQGSVLKAILQAKSSSSIQGIYGRMGDLGAIDAKYDVAVSTACGGIDYIVVETTAAAQACVAMLRKNNLGVATFMILDFISWLHMVLITGKVNYQDYTRKKSQSYVKNEGKTMGNTVVAKDIDQATRIAYGGNQEFRRVVTLDGALFEKSGTMSGGGNKPRGGSRPAPGEHREEREPGRWKSQGTNHNNKIFDNEVIAKEKMPKMVYDYYAQVLRIRALWEENSPRWKKTGTIQKNPI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G168020`
TK1151 ID	TkA01G168020
OH-1004 ID	LXL04_029167
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.000
Protein coverage (%)	TK1151 89.157 / OH-1004 77.352 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G168020

Location Chr01:43053609-43058094 (-)

Description Similar to SMC4: Structural maintenance of chromosomes protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48600`	Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes.	Disruption of the Arabidopsis SMC4 gene, AtCAP-C, compromises gametogenesis and embryogenesis.2006 · DOI: 10.1007/s00425-006-0234-z

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029167 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000012 single strand break repair Biological Process

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007076 mitotic chromosome condensation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010032 meiotic chromosome condensation Biological Process

GO:0045132 meiotic chromosome segregation Biological Process

GO:0048468 cell development Biological Process

GO:0051301 cell division Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0051383 kinetochore organization Biological Process

GO:0051984 positive regulation of chromosome segregation Biological Process

KEGG gene cross-reference

ath:AT5G48600

ddi:DDB_G0286403

mmu:70099

xla:397799

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.489

Rank 1 · TkA01G168020 · TK1151

Cytoplasm0.485

Rank 2 · TkA01G168020 · TK1151

Cell membrane0.064

Rank 3 · TkA01G168020 · TK1151

Mitochondrion0.049

Rank 4 · TkA01G168020 · TK1151

Endoplasmic reticulum0.047

Rank 5 · TkA01G168020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06470SMC_hinge30-140 aa

PF11778SID86-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G168020	`PF06470`	SMC_hinge	30	140	3.2e-15	57.2
TkA01G168020	`PF11778`	SID	86	119	0.13	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJL0`	Arabidopsis thaliana	sp\|Q9FJL0\|SMC4_ARATH Structural maintenance of chromosomes protein 4	65.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card