TkA01G165240 | RubberDandelionOmics

Gene overview

TkA01G165240

Reference: TK1151 Chr: Chr01 Coordinates: 42210359-42212630 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1323 bp · TkA01G165240|TK1151|cDNA

ATGTATATGAAAACCTACACGTTACATATCCCTCGGCATCAACTCAATTATTTTGCAACTAGCGATTTGCGGGGTATCTTTTTGGCAGCTAAGTTGATCCCCTTGCAGACTTATATGATGTCAGATTTTATATGTGAAGATATGATTGATGAAATCTTTTCAAGACTCCCGCTCAAATCTCTCCTTCGATTTAGATCACTATCCAAATTCTTTTATTGGTATATTGCTAGCCATGGTTTCACCCGAAAACACACCTTACG...

CDS

Download CDS FASTA

1323 bp · TkA01G165240|TK1151|CDS

ATGTATATGAAAACCTACACGTTACATATCCCTCGGCATCAACTCAATTATTTTGCAACTAGCGATTTGCGGGGTATCTTTTTGGCAGCTAAGTTGATCCCCTTGCAGACTTATATGATGTCAGATTTTATATGTGAAGATATGATTGATGAAATCTTTTCAAGACTCCCGCTCAAATCTCTCCTTCGATTTAGATCACTATCCAAATTCTTTTATTGGTATATTGCTAGCCATGGTTTCACCCGAAAACACACCTTACG...

Protein

Download Protein FASTA

440 aa · TkA01G165240|TK1151|PROTEIN

MYMKTYTLHIPRHQLNYFATSDLRGIFLAAKLIPLQTYMMSDFICEDMIDEIFSRLPLKSLLRFRSLSKFFYWYIASHGFTRKHTLRSPQKILIRHRPYHNDFHEDPDFFTLHADNELPLCPKRRYNGTKATQFPFKRNNFFIVGSCNGILCIFEYNLRSKFKYDLINLSLWNPSTGRKLSLPDFPQRRYTRMEIGFGFDKITDDYKIVILSNPDINEGTPQSSLVYAMKTRIWCTIAPPNFIYTKVASNGCFVNGELHW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G165240`
TK1151 ID	TkA01G165240
OH-1004 ID	LXL04_006770
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	43.200
Protein coverage (%)	TK1151 81.136 / OH-1004 93.784 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G165240

Location Chr01:42210359-42212630 (+)

Description Similar to At3g16210: Putative F-box protein At3g16210

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06240`	F-box/kelch-repeat protein At3g06240.	No verified direct reference in this release
`At3g07870`	F-box protein At3g07870.	No verified direct reference in this release
`At1g33530`	Putative F-box protein At1g33530.	No verified direct reference in this release
`At4g12560`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	An F-box gene, CPR30, functions as a negative regulator of the defense response in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03995.x
`At4g17780`	Putative F-box protein At4g17780.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006770 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G47790

ath:AT1G52495

ath:AT3G06240

ath:AT3G16210

ath:AT4G12560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.502

Rank 1 · TkA01G165240 · TK1151

Nucleus0.409

Rank 2 · TkA01G165240 · TK1151

Cell membrane0.123

Rank 3 · TkA01G165240 · TK1151

Endoplasmic reticulum0.087

Rank 4 · TkA01G165240 · TK1151

Mitochondrion0.054

Rank 5 · TkA01G165240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box45-72 aa

PF08268FBA_3130-324 aa

PF03478Beta-prop_KIB1-4131-328 aa

PF07734FBA_1138-296 aa

PF23635Beta-prop_AT5G49610-like144-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G165240	`PF00646`	F-box	45	72	2.9e-05	24.5
TkA01G165240	`PF08268`	FBA_3	130	324	5.9e-20	72.2
TkA01G165240	`PF03478`	Beta-prop_KIB1-4	131	328	8.8e-05	22.9
TkA01G165240	`PF07734`	FBA_1	138	296	8.4e-15	55.3
TkA01G165240	`PF23635`	Beta-prop_AT5G49610-like	144	328	0.012	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXC7`	Arabidopsis thaliana	sp\|Q8GXC7\|FBK50_ARATH F-box/kelch-repeat protein At3g06240	27.600%	Swiss-Prot	Low
`Q9SFC7`	Arabidopsis thaliana	sp\|Q9SFC7\|FB135_ARATH F-box protein At3g07870	25.200%	Swiss-Prot	Low
`Q9C800`	Arabidopsis thaliana	sp\|Q9C800\|FB34_ARATH Putative F-box protein At1g33530	28.400%	Swiss-Prot	Low
`Q9SU30`	Arabidopsis thaliana	sp\|Q9SU30\|CPR1_ARATH F-box protein CPR1	24.800%	Swiss-Prot	Low
`Q3E9Z8`	Arabidopsis thaliana	sp\|Q3E9Z8\|FB236_ARATH Putative F-box protein At4g17780	24.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card