TkA01G164630 | RubberDandelionOmics

Gene overview

TkA01G164630

Reference: TK1151 Chr: Chr01 Coordinates: 42049733-42053131 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1586 bp · TkA01G164630|TK1151|cDNA

GAGGGCCCGTAGACAAAGCCTAAATGGTAAGGTTTCAAAAGCCCAATCACGGCCCATTTAGAATCAACCCTTTCCAGTTCCATTATTATCTCACGACTCACGCACACAGCGAGCGATAGACGCAGATCCACCTTTGAGCTTTGGCGCCTCCTGTAGTGTCGCATAATTGCATATACTAAAATGATGGCAATCGGTGCTTCTGCCCTACAAACAACTCTCACAAGGCCCTCTGTTTTTCTTACTCAAAGAAACCTGGGGTT...

CDS

Download CDS FASTA

1179 bp · TkA01G164630|TK1151|CDS

ATGATGGCAATCGGTGCTTCTGCCCTACAAACAACTCTCACAAGGCCCTCTGTTTTTCTTACTCAAAGAAACCTGGGGTTTACCATGGCAAGTTTTGTGCACGAATCCGATAGATCTTTATCATCCAAGCTTTCTAGCTCTTCTCATGTATCATCAGTTCCAAATGCTAATCAAAGATTCATAACTAATCGTCCAAGGATCCAAAAATTTGTTACAAAATCAATGTCGGAAGGATCTGAAAGCAAATCCACATCCCAACT...

Protein

Download Protein FASTA

392 aa · TkA01G164630|TK1151|PROTEIN

MMAIGASALQTTLTRPSVFLTQRNLGFTMASFVHESDRSLSSKLSSSSHVSSVPNANQRFITNRPRIQKFVTKSMSEGSESKSTSQLSIDLRGKRAFIAGVADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFEMSLRRGKFDASRVLPDGSLMEITKVYPLDAVFDNLEEVPEDIKANKRYAGASNWTVQEVAGSVKKDFGSIDILVHSLANGPEVTKPLLETSRKGYLAAVSASSYSFVSLLKHFLPIMNPGGSSIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G164630`
TK1151 ID	TkA01G164630
OH-1004 ID	LXL04_004368
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G164630

Location Chr01:42049733-42053131 (+)

Description Similar to MOD1: Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g05990`	Catalyzes the NAD-dependent reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP).	Deficiency in fatty acid synthase leads to premature cell death and dramatic alterations in plant morphology.2000 · DOI: 10.1105/tpc.12.3.405

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0327400`	Catalyzes the NAD-dependent reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP).	No verified direct reference in this release
`Os09g0277800`	Catalyzes the NAD-dependent reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004368 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005835 fatty acid synthase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity Molecular Function

GO:0005507 copper ion binding Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ana:all4391

ath:AT2G05990

dosa:Os08g0327400

dosa:Os09g0277800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · TkA01G164630 · TK1151

Mitochondrion0.037

Rank 2 · TkA01G164630 · TK1151

Nucleus0.015

Rank 3 · TkA01G164630 · TK1151

Cytoplasm0.013

Rank 4 · TkA01G164630 · TK1151

Peroxisome0.009

Rank 5 · TkA01G164630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13561adh_short_C2100-124 aa

PF00106adh_short103-124 aa

PF12241Enoyl_reductase188-215 aa

PF13561adh_short_C2190-371 aa

PF00106adh_short190-317 aa

PF12241Enoyl_reductase251-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G164630	`PF13561`	adh_short_C2	100	124	8.4e-54	183.4
TkA01G164630	`PF00106`	adh_short	103	124	1.1e-10	42.1
TkA01G164630	`PF12241`	Enoyl_reductase	188	215	0.00077	19.6
TkA01G164630	`PF13561`	adh_short_C2	190	371	8.4e-54	183.4
TkA01G164630	`PF00106`	adh_short	190	317	1.1e-10	42.1
TkA01G164630	`PF12241`	Enoyl_reductase	251	324	0.00077	19.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLA8`	Arabidopsis thaliana	sp\|Q9SLA8\|FABI_ARATH Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic	86.800%	Swiss-Prot	High
`Q6Z0I4`	Oryza sativa subsp. japonica	sp\|Q6Z0I4\|FABI1_ORYSJ Enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic	88.100%	Swiss-Prot	High
`Q6H5J0`	Oryza sativa subsp. japonica	sp\|Q6H5J0\|FABI2_ORYSJ Enoyl-[acyl-carrier-protein] reductase [NADH] 2, chloroplastic	86.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card