TkA01G164400 | RubberDandelionOmics

Gene overview

TkA01G164400

Reference: TK1151 Chr: Chr01 Coordinates: 41984139-41987740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2708 bp · TkA01G164400|TK1151|cDNA

ACCATACCACATAGCCTTAACCCTTCAAACCAGTTTTTAAATTTTAGAACTGAAAATGACCTAAATATCCTCAATACCCTCAAACACAAAACAAAATTGGGAGCCGCCTCTTCTGCACAGACGCACGACGCACACACAGCAGCTCCGTTCTCCTCCTTTGTCGCTGCCGATCCCAGGCGCATCCGACCTCCGGCGCACTGCAGGCCAACGCTTAAGACTGCCGCCGCCTCTCCTCCTAGCACCACCCGCCCTACCTCCGA...

CDS

Download CDS FASTA

2508 bp · TkA01G164400|TK1151|CDS

ACCATACCACATAGCCTTAACCCTTCAAACCAGTTTTTAAATTTTAGAACTGAAAATGACCTAAATATCCTCAATACCCTCAAACACAAAACAAAATTGGGAGCCGCCTCTTCTGCACAGACGCACGACGCACACACAGCAGCTCCGTTCTCCTCCTTTGTCGCTGCCGATCCCAGGCGCATCCGACCTCCGGCGCACTGCAGGCCAACGCTTAAGACTGCCGCCGCCTCTCCTCCTAGCACCACCCGCCCTACCTCCGA...

Protein

Download Protein FASTA

835 aa · TkA01G164400|TK1151|PROTEIN

TIPHSLNPSNQFLNFRTENDLNILNTLKHKTKLGAASSAQTHDAHTAAPFSSFVAADPRRIRPPAHCRPTLKTAAASPPSTTRPTSERPLAPLAINMGSKKKDKKPKKVSSKDEQKEDNIEEAPIKSVENASEHKSQLQRLSEKDPEFYEFLKEHDQELLEFDEEGDGETDMDDDDVTQEGKDDDEDEDPINQTQDSSQKQDESSIKTITSEMVDSWCKSIHEEQKVGAIRSIMRAFRSACHCGDDDSEAKLSAMSFPVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G164400`
TK1151 ID	TkA01G164400
OH-1004 ID	LXL04_002071
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	37.100
Protein coverage (%)	TK1151 57.485 / OH-1004 65.034 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G164400

Location Chr01:41984139-41987740 (+)

Description Similar to At2g18220: Nucleolar complex protein 2 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g18220`	Together with SWA2, probably involved in pre-ribosome export from the nucleus to the cytoplasm.	SLOW WALKER2, a NOC1/MAK21 homologue, is essential for coordinated cell cycle progression during female gametophyte development in Arabidopsis.2009 · DOI: 10.1104/pp.109.142414
`At3g55510`	Collaboratively with CYP40/SQN and ULT1, influences floral meristem (FM) determinacy in an AGAMOUS and SUPERMAN-dependent manner, thus contributing to the floral developmental homeostasis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0495500`	Nucleolar complex protein 2 homolog.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002071 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0030690 Noc1p-Noc2p complex Cellular Component

GO:0030691 Noc2p-Noc3p complex Cellular Component

GO:0003714 transcription corepressor activity Molecular Function

GO:0042393 histone binding Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT2G18220

ath:AT3G55510

bta:508638

dosa:Os10g0495500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · TkA01G164400 · TK1151

Cytoplasm0.090

Rank 2 · TkA01G164400 · TK1151

Cell membrane0.026

Rank 3 · TkA01G164400 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA01G164400 · TK1151

Plastid0.010

Rank 5 · TkA01G164400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04889Cwf_Cwc_15102-189 aa

PF03715Noc2385-678 aa

PF04889Cwf_Cwc_15611-721 aa

PF04889Cwf_Cwc_15743-826 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G164400	`PF04889`	Cwf_Cwc_15	102	189	0.11	13.1
TkA01G164400	`PF03715`	Noc2	385	678	5.3e-104	348.3
TkA01G164400	`PF04889`	Cwf_Cwc_15	611	721	0.11	13.1
TkA01G164400	`PF04889`	Cwf_Cwc_15	743	826	0.11	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPV5`	Arabidopsis thaliana	sp\|Q9ZPV5\|NOC2_ARATH Nucleolar complex-associated protein 2	64.200%	Swiss-Prot	High
`Q0WVH0`	Arabidopsis thaliana	sp\|Q0WVH0\|RBLOT_ARATH Protein REBELOTE	35.400%	Swiss-Prot	Medium
`Q8LNU5`	Oryza sativa subsp. japonica	sp\|Q8LNU5\|NOC2L_ORYSJ Nucleolar complex protein 2 homolog	52.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card