TkA01G157760 | RubberDandelionOmics

Gene overview

TkA01G157760

Reference: TK1151 Chr: Chr01 Coordinates: 40331391-40334430 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2087 bp · TkA01G157760|TK1151|cDNA

CGACTATCGTTGAACAGTGGTAAAACAGTAATAGCGTAAGTTTGTACGAATGGCAGCCATTGACCCCGTTTCCCAACACAATTCACATGTGTGTGGAGATAGCCAAATCTCACCTGGCACTTGGCACAAAGTGTCAAACCCATGACCACCATTTTTGATAATCATCAATGGTGGCTACCTCACTTCCCATTGGCTGCATCCCACTGACTTCAATTTCCCCTGCTTTCTTCTTGCTTCTTCTTCAGAACCCCTTTCTTTAT...

CDS

Download CDS FASTA

1218 bp · TkA01G157760|TK1151|CDS

ATGGATTCAGATCTCCATCATCATCATCATCATCATCATCACCAGCTGCAGCAGCCACAGCAAAACATGACCACTGGTTTGACGCGATACCGATCCGCACCGAGTTCGTATTTCTCCAACTTGATTAACAATGGAATATATGGAGACGACGACGGCGACCCGTTTTTCAATCCTCGGGTTTCAAGCACCGAAACGGATCAGATTTTTTCGAGATTCTCGTCCTCCACCGCCGACGCTGTTGCTGTTAGTGGTGGTGATTC...

Protein

Download Protein FASTA

405 aa · TkA01G157760|TK1151|PROTEIN

MDSDLHHHHHHHHHQLQQPQQNMTTGLTRYRSAPSSYFSNLINNGIYGDDDGDPFFNPRVSSTETDQIFSRFSSSTADAVAVSGGDSTSHQIMNQIGGYDAQFMDSVKQEQGGIYPESLQQQQPMIYQNQFQSQPDQINQSASTCTSAKDDSLPAMNLPTNLLRQSSSPAGFFSHLDIDNGYHSMRSMDDFRSGRGSVQNPLLPTKRLKNELGFSGNSYSSSGILPRIPENEGKTMDMKSHLKDEDFVTRYQSGSWDDSD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G157760`
TK1151 ID	TkA01G157760
OH-1004 ID	LXL04_012988
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	56.400
Protein coverage (%)	TK1151 95.802 / OH-1004 94.406 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G157760

Location Chr01:40331391-40334430 (+)

Description Similar to BHLH122: Transcription factor bHLH122

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42280`	Transcription factor bHLH130.	No verified direct reference in this release
`At1g51140`	Transcription factor bHLH122.	No verified direct reference in this release
`At1g05805`	Transcription factor bHLH128.	No verified direct reference in this release
`At2g43140`	Transcription factor bHLH129.	No verified direct reference in this release
`At4g09180`	Transcription factor bHLH81.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012988 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006808 regulation of nitrogen utilization Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010119 regulation of stomatal movement Biological Process

KEGG gene cross-reference

ath:AT1G05805

ath:AT1G35460

ath:AT1G51140

ath:AT2G42280

ath:AT4G09180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · TkA01G157760 · TK1151

Cytoplasm0.102

Rank 2 · TkA01G157760 · TK1151

Cell membrane0.024

Rank 3 · TkA01G157760 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA01G157760 · TK1151

Plastid0.011

Rank 5 · TkA01G157760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16789YscO-like3-28 aa

PF00781DAGK_cat64-98 aa

PF25696Phage_Gp168243-252 aa

PF25696Phage_Gp168251-275 aa

PF23177bHLH_IRO3341-398 aa

PF00010HLH342-387 aa

PF23173bHLH_SAC51345-394 aa

PF16789YscO-like345-391 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G157760	`PF16789`	YscO-like	3	28	0.22	12.2
TkA01G157760	`PF00781`	DAGK_cat	64	98	0.18	12.1
TkA01G157760	`PF25696`	Phage_Gp168	243	252	0.036	15.0
TkA01G157760	`PF25696`	Phage_Gp168	251	275	0.036	15.0
TkA01G157760	`PF23177`	bHLH_IRO3	341	398	0.0029	18.6
TkA01G157760	`PF00010`	HLH	342	387	4.9e-10	39.8
TkA01G157760	`PF23173`	bHLH_SAC51	345	394	6.9e-06	26.6
TkA01G157760	`PF16789`	YscO-like	345	391	0.22	12.2
TkA01G157760	`PF23174`	bHLH_ILI	351	398	0.017	16.2
TkA01G157760	`PF25696`	Phage_Gp168	373	393	0.036	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66GR3`	Arabidopsis thaliana	sp\|Q66GR3\|BH130_ARATH Transcription factor bHLH130	50.400%	Swiss-Prot	Medium
`Q9C690`	Arabidopsis thaliana	sp\|Q9C690\|BH122_ARATH Transcription factor bHLH122	38.500%	Swiss-Prot	Medium
`Q8H102`	Arabidopsis thaliana	sp\|Q8H102\|BH128_ARATH Transcription factor bHLH128	40.800%	Swiss-Prot	Medium
`Q9ZW81`	Arabidopsis thaliana	sp\|Q9ZW81\|BH129_ARATH Transcription factor bHLH129	40.500%	Swiss-Prot	Medium
`Q9M0R0`	Arabidopsis thaliana	sp\|Q9M0R0\|BH081_ARATH Transcription factor bHLH81	61.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card