RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G155380
Reference: TK1151 Chr: Chr01 Coordinates: 39393064-39398120 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1412 bp · TkA01G155380|TK1151|cDNA

AGTAACGGGGATTTATCCGAAAAGTTGGATACCAAAAGCGATGGATGAGTTCGAGCTTGCGTTACAGTTTAGCATATCGGTTCTTGTTGTAGCGTGCCCATGCGCTTTAGGGTTAGCCACTCCTACCGCGGTTATGGTTGCTACTGGTAAAGGTGCATCCCAAGGAGTACTCATCAAAGGCGGAAATGCCCTAGAAAAAGCCCACAAGGTACTATATACTATAGTCTATAGATACAACATCACTTCATCAAATTATAGTT...

CDS

Download CDS FASTA

2646 bp · TkA01G155380|TK1151|CDS

ATGGACGTTAATGGGAGAGAAGATCTAAACAGACCATTTCTGGAAGAAGCCATGAAAGTTGCAGGTATTAAAATCACCGAGTTTCCAGATCAAGAGATAGCAGTATGCCGCCTCAAAATCAAGGGAATGACGTGCACAAGTTGCTCTGAATCGATTGAAACCTCTCTTTTAATGGTGGAAGGAGTGAAAAAGGCTGTCGTGGGTTTAGCTCTTGAAGAAGCAAAGATAAACTACGATCCAAATGTCACAAATACAACTAA...

Protein

Download Protein FASTA

881 aa · TkA01G155380|TK1151|PROTEIN

MDVNGREDLNRPFLEEAMKVAGIKITEFPDQEIAVCRLKIKGMTCTSCSESIETSLLMVEGVKKAVVGLALEEAKINYDPNVTNTTKIIEAIVDAGFEADPIGPEIDANKVHIILEGITIISSEDMAAIKQSMELLNGVNHVETNREEFQLTVSYDPNLTGPRSVISFISDRYQARLYIPERKRDTERNHEIKMYRNLFFWSCLFSIPVFVFSMVLPMIPPYGNWLSYKIHNMLTIGMVSRWILCTPVQFIIGRRFYVGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G155380
TK1151 IDTkA01G155380
OH-1004 IDLXL04_004428
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)98.400
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G155380
LocationChr01:39393064-39398120 (-)
DescriptionSimilar to HMA4: Copper-transporting ATPase HMA4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g63440 Involved in copper import into the cell.
The Arabidopsis heavy metal P-type ATPase HMA5 interacts with metallochaperones and functions in copper detoxification of roots.2006 · DOI: 10.1111/j.1365-313x.2005.02601.x
At5g44790 Involved in copper import into the cell. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0196600 Copper (Cu) transporter that mediates Cu transport in root vacuoles.
A heavy metal P-type ATPase OsHMA4 prevents copper accumulation in rice grain.2016 · DOI: 10.1038/ncomms12138
Os04g0556000 Copper (Cu) transporter that plays an essential role in promoting translocation of Cu from roots to shoots.
A member of the heavy metal P-type ATPase OsHMA5 is involved in xylem loading of copper in rice.2013 · DOI: 10.1104/pp.113.226225
Os06g0665800 Metal efflux transporter that may play a role in detoxification of heavy metals, such as zinc, copper, lead and cadmium, especially in the shoots.
Rice P1B-type heavy-metal ATPase, OsHMA9, is a metal efflux protein.2007 · DOI: 10.1104/pp.107.102236
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004428 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0010273 detoxification of copper ion Biological Process
GO:0046688 response to copper ion Biological Process
GO:0055085 transmembrane transport Biological Process
GO:0071280 cellular response to copper ion Biological Process
GO:0005774 vacuolar membrane Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0005507 copper ion binding Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0016887 ATP hydrolysis activity Molecular Function
GO:0140581 P-type monovalent copper transporter activity Molecular Function
KEGG gene cross-reference
ath:AT1G63440
dosa:Os02g0196600
dosa:Os04g0556000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.295
Rank 1 · TkA01G155380 · TK1151
Endoplasmic reticulum0.264
Rank 2 · TkA01G155380 · TK1151
Cytoplasm0.170
Rank 3 · TkA01G155380 · TK1151
Lysosome / Vacuole0.151
Rank 4 · TkA01G155380 · TK1151
Golgi apparatus0.151
Rank 5 · TkA01G155380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04475DUF55515-73 aa
PF00403HMA38-98 aa
PF24534HMA_PCA174-83 aa
PF24534HMA_PCA1120-171 aa
PF00403HMA128-167 aa
PF00122E1-E2_ATPase358-445 aa
PF31064Dro506-525 aa
PF00702Hydrolase555-775 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G155380PF04475DUF55515730.3311.9
TkA01G155380PF00403HMA38981.2e-1661.5
TkA01G155380PF24534HMA_PCA174830.001319.0
TkA01G155380PF24534HMA_PCA11201710.001319.0
TkA01G155380PF00403HMA1281671.2e-1661.5
TkA01G155380PF00122E1-E2_ATPase3584459.2e-2277.5
TkA01G155380PF31064Dro5065250.2811.6
TkA01G155380PF00702Hydrolase5557751.9e-31110.7
TkA01G155380PF31064Dro6847110.2811.6
TkA01G155380PF08282Hydrolase_36997340.008116.6
TkA01G155380PF08282Hydrolase_37498000.008116.6
TkA01G155380PF04475DUF5557867970.3311.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SH30Arabidopsis thalianasp|Q9SH30|HMA5_ARATH Probable copper-transporting ATPase HMA557.000%Swiss-ProtHigh
Q9S7J8Arabidopsis thalianasp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN149.400%Swiss-ProtMedium
Q6H7M3Oryza sativa subsp. japonicasp|Q6H7M3|HMA4_ORYSJ Copper-transporting ATPase HMA468.200%Swiss-ProtHigh
A3AWA4Oryza sativa subsp. japonicasp|A3AWA4|HMA5_ORYSJ Copper-transporting ATPase HMA556.100%Swiss-ProtHigh
A0A0P0X004Oryza sativa subsp. japonicasp|A0A0P0X004|HMA9_ORYSJ Cation-transporting ATPase HMA547.400%Swiss-ProtMedium

JBrowse

View in Genome Browser