TkA01G130640 | RubberDandelionOmics

Gene overview

TkA01G130640

Reference: TK1151 Chr: Chr01 Coordinates: 32988211-32991146 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2081 bp · TkA01G130640|TK1151|cDNA

GCAAGAACGAACCTCCCATAACGCATCCATGGCGAGAGATCTTTTAGGAAATTAAAGCGGGATTTATATTCTCTTCAGAAAATTATGGTGGCTGTGATCTCGCGGTTTTTTTCAAATTCAGGGGTTCATGTCATTGGTCATCGAACACCAATGATTCATATAGAACGAATATGGATTTCACATTTTCATCACTCCAATGTAATCCATTTCTGAAACCTCCTCCCATTCTCGTGAATGTGGTCCTGTAATCGTATTTACCA...

CDS

Download CDS FASTA

1485 bp · TkA01G130640|TK1151|CDS

ATGGCCAGAAGACCGGCAATGTGGAGATTCTCCGGCGTTGCTGCCGTGGCCGTGTTGTTGCAGGGAGTGGTTGTTCTCTGTAAATCTCCGGCGGCGAGTCTCAAACTGGAAAGAGCTTTTCCGCACAATCAACGGGTGGAAATGAGCAAACTTAGAGATCGAGATAATTTAAGGCACTATAGATTCTTGAAGCAACAATCAAAAGATGTTATTGATTTCCAACTTCAGGGCACTTATGATCCTTATCGAGTTGGCCTTTA...

Protein

Download Protein FASTA

494 aa · TkA01G130640|TK1151|PROTEIN

MARRPAMWRFSGVAAVAVLLQGVVVLCKSPAASLKLERAFPHNQRVEMSKLRDRDNLRHYRFLKQQSKDVIDFQLQGTYDPYRVGLYYTKVQLGSPPKEYYVQVDTGSDVLWVSCKDCIGCPTSSGLKVPIEFYDHESSKTSSLVICSDATCLSGIESGDADCKDTSCIYTFKYGDGSATSGYYVSDLIHLEMMSDEINPSSNASSKVMFGCSTSQSGELSDPERAVNGIFGFGQKGVSVISQLTSKGAAPDAFSHCLVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G130640`
TK1151 ID	TkA01G130640
OH-1004 ID	LXL04_004611
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G130640

Location Chr01:32988211-32991146 (-)

Description Similar to At1g65240: Aspartic proteinase-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36260`	Displays aspartic proteolytic activity.	No verified direct reference in this release
`At1g65240`	Displays aspartic proteolytic activity.	No verified direct reference in this release
`At3g18490`	Aspartic protease involved in drought avoidance through abscisic acid signaling.	Overexpression of the aspartic protease ASPG1 gene confers drought avoidance in Arabidopsis.2012 · DOI: 10.1093/jxb/err433

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004611 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009555 pollen development Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G49050

ath:AT1G65240

ath:AT2G17760

ath:AT5G36260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.524

Rank 1 · TkA01G130640 · TK1151

Extracellular0.184

Rank 2 · TkA01G130640 · TK1151

Cytoplasm0.116

Rank 3 · TkA01G130640 · TK1151

Endoplasmic reticulum0.111

Rank 4 · TkA01G130640 · TK1151

Lysosome / Vacuole0.105

Rank 5 · TkA01G130640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543TAXi_N87-272 aa

PF00026Asp87-436 aa

PF14541TAXi_C289-437 aa

PF14543TAXi_N425-459 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G130640	`PF14543`	TAXi_N	87	272	1.3e-38	133.7
TkA01G130640	`PF00026`	Asp	87	436	1.7e-27	97.4
TkA01G130640	`PF14541`	TAXi_C	289	437	1.7e-25	90.4
TkA01G130640	`PF14543`	TAXi_N	425	459	1.3e-38	133.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4V3D2`	Arabidopsis thaliana	sp\|Q4V3D2\|ASP36_ARATH Aspartic proteinase 36	37.700%	Swiss-Prot	Medium
`Q9S9K4`	Arabidopsis thaliana	sp\|Q9S9K4\|ASP39_ARATH Aspartic proteinase 39	36.600%	Swiss-Prot	Medium
`Q9LS40`	Arabidopsis thaliana	sp\|Q9LS40\|ASPG1_ARATH Protein ASPARTIC PROTEASE IN GUARD CELL 1	26.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card