TkA01G128910 | RubberDandelionOmics

Gene overview

TkA01G128910

Reference: TK1151 Chr: Chr01 Coordinates: 32577452-32579739 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1016 bp · TkA01G128910|TK1151|cDNA

TGGACATCGAAATCCAAACAAAAATACCCGCGAACACTAAAAACGCTCAATCAATAAACCCAAATTCCCGCTGGGGGCAGCCATTATTCGGTTTAAGCCGCAAAATCGTCTGAACCAAACCTTCGCGACCGCCGACCCCCGCCGCTTCTTCCCAATTCCGTCTGCCAGACTTCCGTTTGATCTGGTTTTTGATACTATAAGTGAGTTCAAGTATCAAGTCGAGGCAAAAGATTACAAAACACCAGTCTCTTGCTTCAATC...

CDS

Download CDS FASTA

561 bp · TkA01G128910|TK1151|CDS

ATGGCAAACTATTATGACATTGATGACATCCTATCAGAAGAAGAGCTTGTTCCAGTAGTGTTCCTGGAGGCGGTAAATGGAGTTGGTTTGTTCGAATCAAATGAAGCAAATAGGGTAGAACCAAGGTCAAAGGCAGAATTACCATTCTGGCTTGCCCAAGGAATGCACATGAGACAAGGGGTATCTGTCAGCATTCCTCCATGTTTTAATAAAAAGACTCGGGAAGAAATAGGGGCTGATGGTGCACATGTGGACTTAAG...

Protein

Download Protein FASTA

186 aa · TkA01G128910|TK1151|PROTEIN

MANYYDIDDILSEEELVPVVFLEAVNGVGLFESNEANRVEPRSKAELPFWLAQGMHMRQGVSVSIPPCFNKKTREEIGADGAHVDLRSRCSYFYELGCKMVHLVGDKSIGSLLLVAFQTRYKEVLIKAHTAASALTPKFLSLLTKEETKLYDAAKSSTAAFKTWRMGGPRFQKALVLGRKRKPIGE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G128910`
TK1151 ID	TkA01G128910
OH-1004 ID	LXL04_004644
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G128910`
Location	Chr01:32577452-32579739 (+)
Description	Similar to PSF3: DNA replication complex GINS protein PSF3 (Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004644` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000727 double-strand break repair via break-induced replication Biological Process GO:0006260 DNA replication Biological Process GO:0006270 DNA replication initiation Biological Process GO:0035264 multicellular organism growth Biological Process GO:0090398 cellular senescence Biological Process GO:1902975 mitotic DNA replication initiation Biological Process GO:0000785 chromatin Cellular Component GO:0000811 GINS complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0043596 nuclear replication fork Cellular Component
KEGG gene cross-reference	afm:AFUA_4G11620 dha:DEHA2A05808g mmu:78833 pno:SNOG_06210 spo:2541474 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · TkA01G128910 · TK1151

Cytoplasm0.097

Rank 2 · TkA01G128910 · TK1151

Cell membrane0.020

Rank 3 · TkA01G128910 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA01G128910 · TK1151

Mitochondrion0.010

Rank 5 · TkA01G128910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22466PSF3_N5-55 aa

PF25005PSF2_N11-59 aa

PF05916Sld569-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G128910	`PF22466`	PSF3_N	5	55	2.3e-12	47.3
TkA01G128910	`PF25005`	PSF2_N	11	59	0.19	12.5
TkA01G128910	`PF05916`	Sld5	69	164	2.7e-12	47.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card