TkA01G124620 | RubberDandelionOmics

Gene overview

TkA01G124620

Reference: TK1151 Chr: Chr01 Coordinates: 31485392-31488785 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1647 bp · TkA01G124620|TK1151|cDNA

ATGGGGCCAATCCCATTGTCCCATAAGGCCCCCACTCATTCCACCAATAGGAATGAGACACCTCATAGAGCTCTAGAATCTTCCCATATAAGACAAACTGTACTTGGGAGTAAAGAGCATCTTCAGGGGCGTAAAAGGCATCATGGTCTTCACATCCCAACAGTATATATCCCTATTACACCACCACAACGCACAAAAATGGGTCCTCAAAGAAGGTTGAGAATATATGTTGGATATGAGACAACTTCCATCATAAGGTA...

CDS

Download CDS FASTA

1647 bp · TkA01G124620|TK1151|CDS

ATGGGGCCAATCCCATTGTCCCATAAGGCCCCCACTCATTCCACCAATAGGAATGAGACACCTCATAGAGCTCTAGAATCTTCCCATATAAGACAAACTGTACTTGGGAGTAAAGAGCATCTTCAGGGGCGTAAAAGGCATCATGGTCTTCACATCCCAACAGTATATATCCCTATTACACCACCACAACGCACAAAAATGGGTCCTCAAAGAAGGTTGAGAATATATGTTGGATATGAGACAACTTCCATCATAAGGTA...

Protein

Download Protein FASTA

548 aa · TkA01G124620|TK1151|PROTEIN

MGPIPLSHKAPTHSTNRNETPHRALESSHIRQTVLGSKEHLQGRKRHHGLHIPTVYIPITPPQRTKMGPQRRLRIYVGYETTSIIRYHEPLTDLSNSAANQVVGSYTGDVFTARLADCQFDETNFPPLGGKRKFKKGDAMFSYSVACDIMNDDPESQSVIDCQNRHDWAEWKEAMQVELNSLNNINVFGPIVLTPGVVKPLGYRWIFVRKRNENDEIVRYKARLVAKGFSQRPGIDYEEAYSPVMDATTFRYLISLAVSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G124620`
TK1151 ID	TkA01G124620
OH-1004 ID	LXL04_009584
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.200
Protein coverage (%)	TK1151 89.964 / OH-1004 54.568 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G124620

Location Chr01:31485392-31488785 (+)

Description Similar to GIP: Copia protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P92519`	Uncharacterized mitochondrial protein AtMg00810.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009584 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0071897 DNA biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0042575 DNA polymerase complex Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

KEGG gene cross-reference

ath:AT5G50100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.567

Rank 1 · TkA01G124620 · TK1151

Nucleus0.243

Rank 2 · TkA01G124620 · TK1151

Mitochondrion0.134

Rank 3 · TkA01G124620 · TK1151

Peroxisome0.072

Rank 4 · TkA01G124620 · TK1151

Cell membrane0.054

Rank 5 · TkA01G124620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25597SH3_retrovirus55-88 aa

PF07727RVT_2191-293 aa

PF08847Crr6203-239 aa

PF07727RVT_2312-396 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G124620	`PF25597`	SH3_retrovirus	55	88	0.031	14.8
TkA01G124620	`PF07727`	RVT_2	191	293	1.2e-46	160.1
TkA01G124620	`PF08847`	Crr6	203	239	0.24	11.8
TkA01G124620	`PF07727`	RVT_2	312	396	1.2e-46	160.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92519`	Arabidopsis thaliana	sp\|P92519\|M810_ARATH Uncharacterized mitochondrial protein AtMg00810	31.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card