TkA01G122460 | RubberDandelionOmics

Gene overview

TkA01G122460

Reference: TK1151 Chr: Chr01 Coordinates: 31034094-31036909 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1675 bp · TkA01G122460|TK1151|cDNA

GTGATATCATAAGTTCCCTTCAAAGACATAAAAGAGTTGCTTATCCAACTCATTTCAGGCTAGCCCATTTCTTAACGCAATCATTGAACTTGAATATCCACCGCTGTCCAATAGAATATGCTCCCACCATCGCCATGTGCTGACTGACCGTTGACCGTTTCCAGTTTATCTCTGGCAAGAAATTAACTACAAAAACCGAAACTTTACGACAAAAATCATCATCAATCTCACCTGTACATATCCACGTAGACTCTGTATGT...

CDS

Download CDS FASTA

1116 bp · TkA01G122460|TK1151|CDS

ATGGTGTTAAAGAGAGTTGTGGGGCTGATGATGGGTTGTTTGGGAATGAGTTGTTTGCGAATAGCTGATCAGCCGACAAGACCTGCACCTTCAGAGTGTGATTCACCATCTTCATCGGATATGATCGAATCTGGTGATCTCAAAGATATAAAGTCATCGTCTTCTTCTTCATCGGGTAGAATCAAACTCAGTGATGGAAGATACTTAGCTTACAAAGAACGAGGAGTCCCGAGGAATGAATCGAATTACAGAGTCATTAT...

Protein

Download Protein FASTA

371 aa · TkA01G122460|TK1151|PROTEIN

MVLKRVVGLMMGCLGMSCLRIADQPTRPAPSECDSPSSSDMIESGDLKDIKSSSSSSSGRIKLSDGRYLAYKERGVPRNESNYRVIIVHGFASNKEMNFMATQKLMGELGIYLLQFDRAGYGDSDPNPKRSLKSEASDIQELADQLQLGSKFYLVGVSIGSYPTWSCIKNIPERLAGVALVVPFINYRWPSLPHGLIQDDYRKKLSQWAVWVCRHTPGLLHWWLTQKMFPSSSVLDRNPKFFSNKDLEVLKNTPGYQLLC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G122460`
TK1151 ID	TkA01G122460
OH-1004 ID	LXL04_004688
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G122460`
Location	Chr01:31034094-31036909 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004688` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.450

Rank 1 · TkA01G122460 · TK1151

Endoplasmic reticulum0.211

Rank 2 · TkA01G122460 · TK1151

Cytoplasm0.167

Rank 3 · TkA01G122460 · TK1151

Nucleus0.096

Rank 4 · TkA01G122460 · TK1151

Peroxisome0.084

Rank 5 · TkA01G122460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146Hydrolase_483-205 aa

PF00561Abhydrolase_184-201 aa

PF12697Abhydrolase_685-344 aa

PF29246Tp0900_N85-143 aa

PF24102FLAD1_M142-166 aa

PF10230LIDHydrolase145-230 aa

PF29246Tp0900_N195-253 aa

PF00561Abhydrolase_1282-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G122460	`PF12146`	Hydrolase_4	83	205	4.6e-09	36.7
TkA01G122460	`PF00561`	Abhydrolase_1	84	201	8e-11	42.8
TkA01G122460	`PF12697`	Abhydrolase_6	85	344	9.6e-08	33.6
TkA01G122460	`PF29246`	Tp0900_N	85	143	0.25	11.5
TkA01G122460	`PF24102`	FLAD1_M	142	166	0.21	12.1
TkA01G122460	`PF10230`	LIDHydrolase	145	230	0.0076	16.7
TkA01G122460	`PF29246`	Tp0900_N	195	253	0.25	11.5
TkA01G122460	`PF00561`	Abhydrolase_1	282	344	8e-11	42.8
TkA01G122460	`PF10230`	LIDHydrolase	295	327	0.0076	16.7
TkA01G122460	`PF12146`	Hydrolase_4	302	346	4.6e-09	36.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card