TkA01G120640 | RubberDandelionOmics

Gene overview

TkA01G120640

Reference: TK1151 Chr: Chr01 Coordinates: 30571364-30572850 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1020 bp · TkA01G120640|TK1151|cDNA

ATGTCGATGACAGACCGCAAAATAGTCACATTAGCAGTTTGGGTCATCTTCTTCAACCTCGCTGCTCAGTGCTATGGTACTCTCGGCTTTGGTGGTCTTCAGTACGGATTCTACAATGGCAAATGCCGAACTTCAGATGTTGAAGATATCGTAAGAAGAACAGTCTACTCCAAGTTCCTCACTAACCGAAATATTGCCCCGGCTCTCCTTCGCATGCAGTTCCATGATTGTTTTGTCAATGGTTGTGATGCGTCCATCCT...

CDS

Download CDS FASTA

1020 bp · TkA01G120640|TK1151|CDS

ATGTCGATGACAGACCGCAAAATAGTCACATTAGCAGTTTGGGTCATCTTCTTCAACCTCGCTGCTCAGTGCTATGGTACTCTCGGCTTTGGTGGTCTTCAGTACGGATTCTACAATGGCAAATGCCGAACTTCAGATGTTGAAGATATCGTAAGAAGAACAGTCTACTCCAAGTTCCTCACTAACCGAAATATTGCCCCGGCTCTCCTTCGCATGCAGTTCCATGATTGTTTTGTCAATGGTTGTGATGCGTCCATCCT...

Protein

Download Protein FASTA

339 aa · TkA01G120640|TK1151|PROTEIN

MSMTDRKIVTLAVWVIFFNLAAQCYGTLGFGGLQYGFYNGKCRTSDVEDIVRRTVYSKFLTNRNIAPALLRMQFHDCFVNGCDASILLDGPNSEKTAPPNLSVRGYNVIDAAKTAVEKICPGIVSCADIIVMATRDVVSFSGGARYRVQTGRRDGLVSLAQNTLTLPPPSSSVTNAIRSFNLKGLTATDMIYLLGGHTIGIAHCSLFQDRLYNFKNTGKPDPTMELGLLTSLKSKCPQNATVDGTANLDQNPFSSRVVDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G120640`
TK1151 ID	TkA01G120640
OH-1004 ID	LXL04_004705
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G120640

Location Chr01:30571364-30572850 (-)

Description Similar to PER60: Peroxidase 60

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22410`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At5g17820`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At5g64120`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release
`At4g26010`	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004705 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009808 lignin metabolic process Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0045730 respiratory burst Biological Process

GO:0048511 rhythmic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

KEGG gene cross-reference

ath:AT4G26010

ath:AT5G17820

ath:AT5G22410

ath:AT5G64120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.734

Rank 1 · TkA01G120640 · TK1151

Cell membrane0.060

Rank 2 · TkA01G120640 · TK1151

Cytoplasm0.055

Rank 3 · TkA01G120640 · TK1151

Lysosome / Vacuole0.039

Rank 4 · TkA01G120640 · TK1151

Endoplasmic reticulum0.037

Rank 5 · TkA01G120640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00141peroxidase51-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G120640	`PF00141`	peroxidase	51	293	7.3e-76	255.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMR0`	Arabidopsis thaliana	sp\|Q9FMR0\|PER60_ARATH Peroxidase 60	49.500%	Swiss-Prot	Medium
`Q43729`	Arabidopsis thaliana	sp\|Q43729\|PER57_ARATH Peroxidase 57	48.400%	Swiss-Prot	Medium
`Q43387`	Arabidopsis thaliana	sp\|Q43387\|PER71_ARATH Peroxidase 71	45.800%	Swiss-Prot	Medium
`Q93V93`	Arabidopsis thaliana	sp\|Q93V93\|PER44_ARATH Peroxidase 44	47.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card