RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G120600
Reference: TK1151 Chr: Chr01 Coordinates: 30557806-30559536 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1176 bp · TkA01G120600|TK1151|cDNA

ATGGTCACCAAACTATTTGTTCCAGTCTTTCTTTTTCTCCTCTTCCAGTACTCATCATCAGCAAAGATAACTTATAACGTCCTAAGTTTTGGAGCCAAAGCCAACGGCCTCATAGACTCTAAAAGTGCCTTCCTAAAAGCATGGGGTTTGGCTTGTAACTCCACTAATGCCGCCATCATCTATGTGCCCACAGGCAGGTACTTGATTGCATCTGCCCTCACATTCTCTGGGCAAGCATGTAAGAGCAAAGCCATCACAAT...

CDS

Download CDS FASTA

1176 bp · TkA01G120600|TK1151|CDS

ATGGTCACCAAACTATTTGTTCCAGTCTTTCTTTTTCTCCTCTTCCAGTACTCATCATCAGCAAAGATAACTTATAACGTCCTAAGTTTTGGAGCCAAAGCCAACGGCCTCATAGACTCTAAAAGTGCCTTCCTAAAAGCATGGGGTTTGGCTTGTAACTCCACTAATGCCGCCATCATCTATGTGCCCACAGGCAGGTACTTGATTGCATCTGCCCTCACATTCTCTGGGCAAGCATGTAAGAGCAAAGCCATCACAAT...

Protein

Download Protein FASTA

391 aa · TkA01G120600|TK1151|PROTEIN

MVTKLFVPVFLFLLFQYSSSAKITYNVLSFGAKANGLIDSKSAFLKAWGLACNSTNAAIIYVPTGRYLIASALTFSGQACKSKAITIKIDGTLVAPSSYNAIGNAQVWIKLYRANHVTISGGTLDAQGGSLWACKSSGKTCPKGATTLGIYHSQNIVISNLRSINSQMFHIILYACNNAKLKGVSISAPRLSPNTDGIHLSSSTGVTILNSKISTGDDCVSIGPGSSNVWIEKMVCGPGHGISIGSLGWDVEEAGVQNVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G120600
TK1151 IDTkA01G120600
OH-1004 IDLXL04_004707
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)84.200
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G120600
LocationChr01:30557806-30559536 (+)
DescriptionSimilar to Polygalacturonase
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g43860 Probable polygalacturonase At2g43860. No verified direct reference in this release
At3g07970 Polygalacturonase required for cell type-specific pectin degradation to separate microspores.
ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE1 (ADPG1), ADPG2, and QUARTET2 are Polygalacturonases required for cell separation during reproductive development in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063768
Tetrad analysis possible in Arabidopsis with mutation of the QUARTET (QRT) genes.1994 · DOI: 10.1126/science.8197459
At2g41850 Polygalacturonase involved in cell separation in the final stages of pod shatter, in anther dehiscence and in floral organ abscission.
Expression of polygalacturonases and evidence to support their role during cell separation processes in Arabidopsis thaliana.2007 · DOI: 10.1093/jxb/erm222
ARABIDOPSIS DEHISCENCE ZONE POLYGALACTURONASE1 (ADPG1), ADPG2, and QUARTET2 are Polygalacturonases required for cell separation during reproductive development in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063768

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004707 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0005975 carbohydrate metabolic process Biological Process
GO:0009555 pollen development Biological Process
GO:0009835 fruit ripening Biological Process
GO:0009846 pollen germination Biological Process
GO:0045490 pectin catabolic process Biological Process
GO:0048868 pollen tube development Biological Process
GO:0071555 cell wall organization Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0031982 vesicle Cellular Component
GO:0043667 pollen wall Cellular Component
KEGG gene cross-reference
ath:AT2G43860
ghi:107942091
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.848
Rank 1 · TkA01G120600 · TK1151
Cytoplasm0.053
Rank 2 · TkA01G120600 · TK1151
Cell membrane0.041
Rank 3 · TkA01G120600 · TK1151
Endoplasmic reticulum0.037
Rank 4 · TkA01G120600 · TK1151
Lysosome / Vacuole0.028
Rank 5 · TkA01G120600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05048NosD16-29 aa
PF12708Pect-lyase_RHGA_epim26-275 aa
PF00295Glyco_hydro_2852-380 aa
PF05048NosD96-216 aa
PF18889Beta_helix_3117-129 aa
PF23376Fn3_VIN3127-175 aa
PF21803Nab2-zf4137-141 aa
PF13229Beta_helix146-278 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G120600PF05048NosD16290.0009419.4
TkA01G120600PF12708Pect-lyase_RHGA_epim262753.7e-1040.7
TkA01G120600PF00295Glyco_hydro_28523807.2e-86288.9
TkA01G120600PF05048NosD962160.0009419.4
TkA01G120600PF18889Beta_helix_31171290.01416.4
TkA01G120600PF23376Fn3_VIN31271750.1213.2
TkA01G120600PF21803Nab2-zf41371417.77.1
TkA01G120600PF13229Beta_helix1462780.001419.0
TkA01G120600PF13229Beta_helix1972910.001419.0
TkA01G120600PF12708Pect-lyase_RHGA_epim2803003.7e-1040.7
TkA01G120600PF05048NosD3013010.0009419.4
TkA01G120600PF21803Nab2-zf43053187.77.1
TkA01G120600PF23376Fn3_VIN33313410.1213.2
TkA01G120600PF21803Nab2-zf43473547.77.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O22818Arabidopsis thalianasp|O22818|PGLR6_ARATH Probable polygalacturonase At2g4386055.000%Swiss-ProtHigh
Q9SFB7Arabidopsis thalianasp|Q9SFB7|QRT2_ARATH Polygalacturonase QRT243.500%Swiss-ProtMedium
Q8RY29Arabidopsis thalianasp|Q8RY29|ADPG2_ARATH Polygalacturonase ADPG241.500%Swiss-ProtMedium

JBrowse

View in Genome Browser