Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1428 bp · TkA01G118430|TK1151|cDNA
ATGGAAGCTCTCATCACTCCATTATCATCCCTTCCACCTTCTCTTTCTCAAAAACCTCCTTCTTCTTCTTTCTCGCCATTAACAACCTCACCTCTTTTCTTCCAAAAGCCTCACAAACACCTCCGTCACAGAATCCAAAACAGCAAGTATGGCAACTTCCTCGATTTGATCCCTGAAAACAAATCCGAACCCATCAAATTCGACGTCAATTGGCTTGATCCATCGCAAAAAACACGACTCGACCTTATAATAATCGGTAC...
1428 bp · TkA01G118430|TK1151|CDS
ATGGAAGCTCTCATCACTCCATTATCATCCCTTCCACCTTCTCTTTCTCAAAAACCTCCTTCTTCTTCTTTCTCGCCATTAACAACCTCACCTCTTTTCTTCCAAAAGCCTCACAAACACCTCCGTCACAGAATCCAAAACAGCAAGTATGGCAACTTCCTCGATTTGATCCCTGAAAACAAATCCGAACCCATCAAATTCGACGTCAATTGGCTTGATCCATCGCAAAAAACACGACTCGACCTTATAATAATCGGTAC...
Protein
Download Protein FASTA475 aa · TkA01G118430|TK1151|PROTEIN
MEALITPLSSLPPSLSQKPPSSSFSPLTTSPLFFQKPHKHLRHRIQNSKYGNFLDLIPENKSEPIKFDVNWLDPSQKTRLDLIIIGTGPAGLCLAERVARYGIRVCCVDPDPLSMWPNNYGAWIDELSCLDLDDCFDKTWPMASVHIDDHKTKYLDRAYGRINRKKLKTKLLSGCVSNGVKFHKAKAWKVNHQEFESSIVCDDGNELKASLIVDASGFASSFVEYDKPRNHGYQIAHGILAEVEEHPFDLDKMLLMDWRD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G118430 |
|---|---|
| TK1151 ID | TkA01G118430 |
| OH-1004 ID | LXL04_004718 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 94.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G118430 |
|---|---|
| Location | Chr01:30029912-30031402 (-) |
| Description | Similar to CCS: Capsanthin/capsorubin synthase, chromoplastic |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006744 ubiquinone biosynthetic process Biological Process GO:0009688 abscisic acid biosynthetic process Biological Process GO:0016117 carotenoid biosynthetic process Biological Process GO:0016123 xanthophyll biosynthetic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component GO:0009509 chromoplast Cellular Component GO:0009536 plastid Cellular Component GO:0009975 cyclase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function GO:0034020 neoxanthin synthase activity Molecular Function |
| KEGG gene cross-reference | ag:CAA53759 cann:107875664 sly:543649 sly:544104 sot:102601215 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01946Thi479-108 aaPF05834Lycopene_cycl81-306 aaPF07992Pyr_redox_281-109 aaPF01266DAO81-112 aaPF01494FAD_binding_381-109 aaPF03486HI0933_like81-109 aaPF00890FAD_binding_281-110 aaPF12831FAD_oxidored81-112 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G118430 | PF01946 | Thi4 | 79 | 108 | 0.00086 | 19.3 |
| TkA01G118430 | PF05834 | Lycopene_cycl | 81 | 306 | 2.9e-125 | 419.0 |
| TkA01G118430 | PF07992 | Pyr_redox_2 | 81 | 109 | 9.3e-06 | 26.0 |
| TkA01G118430 | PF01266 | DAO | 81 | 112 | 6.7e-05 | 23.3 |
| TkA01G118430 | PF01494 | FAD_binding_3 | 81 | 109 | 7.5e-05 | 22.8 |
| TkA01G118430 | PF03486 | HI0933_like | 81 | 109 | 0.00097 | 19.4 |
| TkA01G118430 | PF00890 | FAD_binding_2 | 81 | 110 | 0.0068 | 16.4 |
| TkA01G118430 | PF12831 | FAD_oxidored | 81 | 112 | 0.15 | 12.1 |
| TkA01G118430 | PF04820 | Trp_halogenase | 82 | 102 | 0.00011 | 22.0 |
| TkA01G118430 | PF13454 | NAD_binding_9 | 83 | 113 | 0.016 | 15.9 |
| TkA01G118430 | PF13450 | NAD_binding_8 | 84 | 110 | 0.002 | 19.1 |
| TkA01G118430 | PF01266 | DAO | 148 | 223 | 6.7e-05 | 23.3 |
| TkA01G118430 | PF04820 | Trp_halogenase | 151 | 224 | 0.00011 | 22.0 |
| TkA01G118430 | PF03486 | HI0933_like | 163 | 220 | 0.00097 | 19.4 |
| TkA01G118430 | PF01494 | FAD_binding_3 | 170 | 221 | 7.5e-05 | 22.8 |
| TkA01G118430 | PF07992 | Pyr_redox_2 | 172 | 220 | 9.3e-06 | 26.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.