TkA01G118190 | RubberDandelionOmics

Gene overview

TkA01G118190

Reference: TK1151 Chr: Chr01 Coordinates: 29954750-29959116 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2235 bp · TkA01G118190|TK1151|cDNA

AGTTTGTGCATTTTGTCCTAATTACGTAAAGGCTTCCGTGCCTTTGCTGGTGTTAGACTTAAAATACTCCATAGTTAACACGCCCAAAATACTGCTCGACCAAATCTCGGATCGGGAGAAACCTTTCCAGAAACACGACGGCATTGTTGTTCTCCGATCAATCTTTGAATTCACGTGGTTGTAAATTCGATTTGCTATCATTTCCTGCTGTTTCTACAACTTCGTTGCGTGAATCGTTCGATCTGAGATTCGATCGATTG...

CDS

Download CDS FASTA

1431 bp · TkA01G118190|TK1151|CDS

ATGCTGAAACGCAATCGTCAACCACAGTACAATGAGTCCCTCTCCGACAAAGTTCATCGCTACCGCGGGGCCATTCTGGTCATTTCGATACCTCTCCTCCTCATCTCCTTCGTTTTGTTTCTGATGCCTTCTGCGCGGTCTCCCAGCAATGCTGGTTTGCCTGCTAACCGTAAGTTTTCGCCAAATTACGTGCTACAAAAGGATCCGTCATCGACTAGGTATGCTGTGATCTTTGATGCTGGCAGTTCGGGGAGTAGAGT...

Protein

Download Protein FASTA

476 aa · TkA01G118190|TK1151|PROTEIN

MLKRNRQPQYNESLSDKVHRYRGAILVISIPLLLISFVLFLMPSARSPSNAGLPANRKFSPNYVLQKDPSSTRYAVIFDAGSSGSRVHVFCFDQNLDLVHIGKELELFEQLTPGLSAFASDPKAAADSLLPLLQKSEAAVPRDLRQNTPVKVGATAGLRQLGVDASERILQSVKDFLKVKSNLKSNDDWVTVLDGTQEGAYQWVTINYLLKRLGQKYSETVGVVDLGGGSVQMAYALSEEDAAKAPRVLNGEDTYVKEMF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G118190`
TK1151 ID	TkA01G118190
OH-1004 ID	LXL04_011468
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	35.300
Protein coverage (%)	TK1151 45.168 / OH-1004 35.445 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G118190

Location Chr01:29954750-29959116 (-)

Description Similar to APY6: Probable apyrase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18280`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates.	Disruption of apyrases inhibits pollen germination in Arabidopsis.2003 · DOI: 10.1104/pp.102.014308 Developmental defects and seedling lethality in apyrase AtAPY1 and AtAPY2 double knockout mutants.2007 · DOI: 10.1007/s11103-007-9184-5
`At3g04080`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates.	Disruption of apyrases inhibits pollen germination in Arabidopsis.2003 · DOI: 10.1104/pp.102.014308 Apyrases (nucleoside triphosphate-diphosphohydrolases) play a key role in growth control in Arabidopsis.2007 · DOI: 10.1104/pp.107.097568 Developmental defects and seedling lethality in apyrase AtAPY1 and AtAPY2 double knockout mutants.2007 · DOI: 10.1007/s11103-007-9184-5 Extracellular nucleotides and apyrases regulate stomatal aperture in Arabidopsis.2011 · DOI: 10.1104/pp.111.174466

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0328400`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates.	No verified direct reference in this release
`Os07g0682800`	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011468 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007186 G protein-coupled receptor signaling pathway Biological Process

GO:0009134 nucleoside diphosphate catabolic process Biological Process

GO:0009181 purine ribonucleoside diphosphate catabolic process Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0033602 negative regulation of dopamine secretion Biological Process

GO:0046032 ADP catabolic process Biological Process

GO:2001170 negative regulation of ATP biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005604 basement membrane Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G14230

ath:AT1G14240

ath:AT1G14250

ath:AT2G02970

mmu:12495

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.767

Rank 1 · TkA01G118190 · TK1151

Endoplasmic reticulum0.118

Rank 2 · TkA01G118190 · TK1151

Cytoplasm0.081

Rank 3 · TkA01G118190 · TK1151

Cell membrane0.056

Rank 4 · TkA01G118190 · TK1151

Extracellular0.043

Rank 5 · TkA01G118190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01150GDA1_CD3968-473 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G118190	`PF01150`	GDA1_CD39	68	473	2.2e-104	350.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SPM5`	Arabidopsis thaliana	sp\|Q9SPM5\|APY2_ARATH Apyrase 2	65.700%	Swiss-Prot	High
`Q9SQG2`	Arabidopsis thaliana	sp\|Q9SQG2\|APY1_ARATH Apyrase 1	59.500%	Swiss-Prot	High
`Q8H7L6`	Oryza sativa subsp. japonica	sp\|Q8H7L6\|APY1_ORYSJ Probable apyrase 1	63.000%	Swiss-Prot	High
`Q6Z4P2`	Oryza sativa subsp. japonica	sp\|Q6Z4P2\|APY2_ORYSJ Probable apyrase 2	61.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card