TkA01G115920 | RubberDandelionOmics

Gene overview

TkA01G115920

Reference: TK1151 Chr: Chr01 Coordinates: 29337685-29341494 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

646 bp · TkA01G115920|TK1151|cDNA

CTAATTTGGCCGTCTTTCTAATTATTATTGGATATCATTTACAGAAAAAGGGAACAGGTAAGTGTGTGAGGGAGAGAATCGGGGAAGATGAAGATTCTGGTGGCACCTTCGACTCTTCGATGCTCGGTCTCCTCAACAAATTCACTCATCCGTAATATTAGTTGTAATCGATTTCTGATCAACAACTATGACCGAAGCAGTAGCAGTTTCGCAATCACGCCACAACTCCTTCCTCGCTCCAAATTTTCTTCCGCAACCTC...

CDS

Download CDS FASTA

1029 bp · TkA01G115920|TK1151|CDS

ATGAAGATTCTGGTGGCACCTTCGACTCTTCGATGCTCGGTCTCCTCAACAAATTCACTCATCCGTAATATTAGTTGTAATCGATTTCTGATCAACAACTATGACCGAAGCAGTAGCAGTTTCGCAATCACGCCACAACTCCTTCCTCGCTCCAAATTTTCTTCCGCAACCTCCGCCAGTTGCCGCCGTCTTCATCCTATCTCCGCCATGGCGTCATCCACTCAAGCACCTTCTCAGAATGCATCATCTGATGATGCGAC...

Protein

Download Protein FASTA

342 aa · TkA01G115920|TK1151|PROTEIN

MKILVAPSTLRCSVSSTNSLIRNISCNRFLINNYDRSSSSFAITPQLLPRSKFSSATSASCRRLHPISAMASSTQAPSQNASSDDATADVFQVIKAHQEKAARLTPIEEVKTILHYSMRGVLSTFSQKHDGYPSGSMVDFACDAHGSPILAVSSLAVHTKDLLANPKCSLLVAKDPEDRTDLVITIHGDAVSVPNEEQDLIRTAYLERHPDAFWVDFGDFQFLRIEPKVVRFVSGVATALLGSGEFTNEEFKAAKVDPIY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G115920`
TK1151 ID	TkA01G115920
OH-1004 ID	LXL04_004748
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G115920

Location Chr01:29337685-29341494 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03890`	Dimeric beta-barrel protein binding to heme and catalyzing its degradation to produce biliverdin.	The Arabidopsis locus AT3G03890 encodes a dimeric β-barrel protein implicated in heme degradation.2020 · DOI: 10.1042/bcj20200712

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004748 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0033014 tetrapyrrole biosynthetic process Biological Process

GO:0042167 heme catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0020037 heme binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G03890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.953

Rank 1 · TkA01G115920 · TK1151

Mitochondrion0.070

Rank 2 · TkA01G115920 · TK1151

Cytoplasm0.044

Rank 3 · TkA01G115920 · TK1151

Nucleus0.029

Rank 4 · TkA01G115920 · TK1151

Peroxisome0.021

Rank 5 · TkA01G115920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10615DUF247085-108 aa

PF01243PNPOx_N108-233 aa

PF13883CREG_beta-barrel111-234 aa

PF10615DUF2470264-337 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G115920	`PF10615`	DUF2470	85	108	1.4e-18	67.9
TkA01G115920	`PF01243`	PNPOx_N	108	233	4.2e-13	50.4
TkA01G115920	`PF13883`	CREG_beta-barrel	111	234	4.5e-16	60.0
TkA01G115920	`PF10615`	DUF2470	264	337	1.4e-18	67.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LDU1`	Arabidopsis thaliana	sp\|Q8LDU1\|HOZ_ARATH Non-canonical heme oxygenase HOZ, chloroplastic	66.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card