TkA01G113550 | RubberDandelionOmics

Gene overview

TkA01G113550

Reference: TK1151 Chr: Chr01 Coordinates: 28817947-28818438 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

492 bp · TkA01G113550|TK1151|cDNA

ATGGCCATAGAAGTTGGTGATAGAGTTGAAGTTATAGGCTTTGAAACAGGCTTTGAACATTCCTACTTTGCAGGGAAAGTAATCGGGTATTATAATGATACCTTTGAGATTCAATATGAAGATCTAGTTGTTACGAAAGATGGAGAACAACTCATCGAAGTAATAGAGACTGCACATGTGAGACCCTATCCCCCACACATCGACTACGACATTAATGATTTTGAGAGAGGAGATGTGGTAGATGTTTGGTACAAAGACGG...

CDS

Download CDS FASTA

492 bp · TkA01G113550|TK1151|CDS

ATGGCCATAGAAGTTGGTGATAGAGTTGAAGTTATAGGCTTTGAAACAGGCTTTGAACATTCCTACTTTGCAGGGAAAGTAATCGGGTATTATAATGATACCTTTGAGATTCAATATGAAGATCTAGTTGTTACGAAAGATGGAGAACAACTCATCGAAGTAATAGAGACTGCACATGTGAGACCCTATCCCCCACACATCGACTACGACATTAATGATTTTGAGAGAGGAGATGTGGTAGATGTTTGGTACAAAGACGG...

Protein

Download Protein FASTA

163 aa · TkA01G113550|TK1151|PROTEIN

MAIEVGDRVEVIGFETGFEHSYFAGKVIGYYNDTFEIQYEDLVVTKDGEQLIEVIETAHVRPYPPHIDYDINDFERGDVVDVWYKDGWWDGIIHDVFYNMNNQKRYEVFFNYMWGKQQYDSYKPEKVRPHQFWVVEDNERTWIPAARVKMEEEVEIIRERRWI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G113550`
TK1151 ID	TkA01G113550
OH-1004 ID	LXL04_013372
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.400
Protein coverage (%)	TK1151 100.000 / OH-1004 28.647 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G113550`
Location	Chr01:28817947-28818438 (-)
Description	Similar to AGDP1: Protein AGENET DOMAIN (AGD)-CONTAINING P1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013372` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0000775 chromosome, centromeric region Cellular Component GO:0000792 heterochromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0042393 histone binding Molecular Function GO:0042803 protein homodimerization activity Molecular Function GO:0140566 histone reader activity Molecular Function
KEGG gene cross-reference	ath:AT1G09320 ath:AT1G26540 ath:AT2G47230 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.791

Rank 1 · TkA01G113550 · TK1151

Cytoplasm0.410

Rank 2 · TkA01G113550 · TK1151

Endoplasmic reticulum0.023

Rank 3 · TkA01G113550 · TK1151

Cell membrane0.021

Rank 4 · TkA01G113550 · TK1151

Mitochondrion0.018

Rank 5 · TkA01G113550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18359Tudor_54-28 aa

PF05641Agenet6-65 aa

PF21743PTM_DIR17_Tudor18-41 aa

PF05641Agenet77-130 aa

PF21743PTM_DIR17_Tudor82-87 aa

PF18359Tudor_584-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G113550	`PF18359`	Tudor_5	4	28	1.4	9.5
TkA01G113550	`PF05641`	Agenet	6	65	6.2e-16	59.3
TkA01G113550	`PF21743`	PTM_DIR17_Tudor	18	41	0.029	14.9
TkA01G113550	`PF05641`	Agenet	77	130	6.2e-16	59.3
TkA01G113550	`PF21743`	PTM_DIR17_Tudor	82	87	0.029	14.9
TkA01G113550	`PF18359`	Tudor_5	84	110	1.4	9.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card